BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30397.Seq (881 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) 99 4e-21 SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) 29 3.8 SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_6636| Best HMM Match : COX7C (HMM E-Value=1.8) 29 5.0 SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) 29 6.6 SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) 29 6.6 SB_44193| Best HMM Match : 7tm_1 (HMM E-Value=4.4e-12) 28 8.7 >SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) Length = 176 Score = 99.1 bits (236), Expect = 4e-21 Identities = 46/57 (80%), Positives = 52/57 (91%) Frame = +1 Query: 61 MNVIQAVKMYITKMTEESGPGMKVILMDKETTSIVSMVYSQSEILQKEVYLFERIDS 231 MNVI AVK Y+TKM EESG GMKV+LMDKETT IVSMVYSQ+E+LQKEVYLFER+D+ Sbjct: 1 MNVILAVKQYVTKMIEESGAGMKVLLMDKETTGIVSMVYSQTEVLQKEVYLFERVDT 57 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/36 (58%), Positives = 27/36 (75%) Frame = +3 Query: 375 ADIKTLAECDEEEAVREVQEVFADYLAVDRHLFSFN 482 A I+ LAE D++E VREVQE +ADY A+ H+FS N Sbjct: 77 ASIRALAEADDQEVVREVQEYYADYFAISPHVFSLN 112 >SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/77 (19%), Positives = 35/77 (45%) Frame = +1 Query: 25 ILCEINKDNLIKMNVIQAVKMYITKMTEESGPGMKVILMDKETTSIVSMVYSQSEILQKE 204 ++CE+ KD+ K + V + + K E G ++ TT + + ++E+++ Sbjct: 15 LICELGKDDFKKTGLPMCVAIKLQKAIESLDKGKELKTSLDSTTIKANKILKKTELIELS 74 Query: 205 VYLFERIDSHAKWDNMN 255 E +++ W+ N Sbjct: 75 KKSLEAQFANSNWNEFN 91 >SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) Length = 238 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 180 TVHHTHYAGSFFIH*YHFHSRAALFRHFSNVHFNCLY--HIHFD*IILI 40 ++HH + +F H Y++H + + H + H + Y H H D I+I Sbjct: 79 SIHHRYR--DYFYHSYNYHHKWQHYHHHHHYHHHLDYDHHYHHDLFIII 125 >SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 524 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -1 Query: 164 TMLVVSLSINITFIPGPLSSVILVMYIL--TACITFILIKLSLFIS 33 T + SLS ++TF+ GPL++ + Y + A + IL L LF S Sbjct: 57 TAWIASLSFSLTFMLGPLTTSLCTKYGVRSVAVLGAILFALGLFCS 102 >SB_6636| Best HMM Match : COX7C (HMM E-Value=1.8) Length = 237 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 436 FLLTTWLWTDTCSLSILLDASKVGLEPTA 522 F L WLWT T SL+ D +VG + A Sbjct: 15 FALYLWLWTSTASLTEAKDNLRVGCDTKA 43 >SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) Length = 356 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -3 Query: 192 DFRLTVHHTHYAGSFFIH*YHFHSRAALFRHFSNVHFNCLYHIHFD 55 D+ H+ +Y + + YH+H H+ + H++ YH H+D Sbjct: 303 DYYYHYHYYYYYDYHYHYDYHYHYDYHYDYHY-DYHYHYDYHYHYD 347 >SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) Length = 341 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -2 Query: 334 YLGSLSSRDNRAM---FSDVGRIKTMHFMCSCYPIWHDCLSSRISKLPSVRFPID 179 YL SL R + ++ + + GR+ T+ +P + D ++ IS++P V P+D Sbjct: 207 YLRSLRKRQDMSVNTTWPNFGRVTTLVAQDMTFPSYDDVINDVISRVPFVDPPLD 261 >SB_44193| Best HMM Match : 7tm_1 (HMM E-Value=4.4e-12) Length = 863 Score = 28.3 bits (60), Expect = 8.7 Identities = 13/43 (30%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = -1 Query: 149 SLSINITFIPGPLSSVILV--MYILTACITFILIKLSLFISQS 27 +L++ F+P + S+++V +YIL C T + + + L+I S Sbjct: 246 TLALLCVFLPPYVPSIMIVWWVYILAICTTMVALHMRLYIISS 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,462,976 Number of Sequences: 59808 Number of extensions: 386863 Number of successful extensions: 971 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 964 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2514529411 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -