BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30396.Seq (860 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 7e-09 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 3e-08 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 56 5e-08 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 9e-08 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 54 2e-07 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 54 2e-07 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 54 2e-07 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 54 2e-07 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 54 2e-07 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 54 2e-07 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 54 2e-07 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 54 2e-07 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 54 2e-07 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 54 2e-07 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 54 2e-07 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 54 2e-07 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 54 2e-07 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 54 2e-07 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 54 2e-07 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 54 2e-07 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 54 2e-07 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 54 2e-07 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 54 2e-07 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 54 2e-07 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 54 2e-07 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 54 2e-07 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 54 2e-07 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 54 2e-07 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 54 2e-07 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 54 2e-07 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 54 2e-07 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 54 2e-07 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 54 2e-07 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 54 2e-07 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 54 2e-07 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 54 2e-07 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 54 2e-07 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 54 2e-07 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 54 2e-07 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 54 2e-07 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 54 2e-07 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 54 2e-07 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 54 2e-07 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 54 2e-07 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 54 2e-07 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 54 2e-07 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 54 2e-07 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 54 2e-07 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 54 2e-07 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 54 2e-07 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 54 2e-07 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 54 2e-07 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 54 2e-07 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 54 2e-07 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 54 2e-07 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 54 2e-07 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 54 2e-07 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 54 2e-07 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 54 2e-07 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 54 2e-07 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 54 2e-07 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 54 2e-07 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 54 2e-07 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 54 2e-07 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 54 2e-07 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 54 2e-07 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 54 2e-07 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 54 2e-07 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 54 2e-07 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 54 2e-07 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 54 2e-07 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 54 2e-07 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 54 2e-07 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 54 2e-07 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 54 2e-07 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 54 2e-07 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 54 2e-07 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 54 2e-07 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 54 2e-07 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 54 2e-07 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 54 2e-07 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 54 2e-07 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 54 2e-07 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 54 2e-07 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 54 2e-07 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 54 2e-07 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 54 2e-07 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 54 2e-07 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 54 2e-07 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 54 2e-07 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_25782| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 52 6e-07 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_20259| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 52 8e-07 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 51 1e-06 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 51 1e-06 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 51 1e-06 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 51 1e-06 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 51 1e-06 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 51 1e-06 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 51 1e-06 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 51 1e-06 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 51 1e-06 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 51 1e-06 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 51 1e-06 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 51 1e-06 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 51 1e-06 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 51 1e-06 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 51 1e-06 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 51 1e-06 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 51 1e-06 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 51 1e-06 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 1e-06 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 116 bits (279), Expect = 2e-26 Identities = 54/63 (85%), Positives = 59/63 (93%) Frame = +2 Query: 257 IRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVAXPRRCEPKKFGGPGARARYQK 436 IRQAISK+L+A+YQKYVDE SKKEI+DILVQYDRSLLVA PRR E KKFGGPGAR+RYQK Sbjct: 45 IRQAISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQK 104 Query: 437 SYR 445 SYR Sbjct: 105 SYR 107 Score = 50.0 bits (114), Expect(2) = 1e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +3 Query: 156 KLQEPILLLGKEKFSMVXIRXTVKGGGHVAQVY 254 K++EPILLLGKE+F V IR VKGGGH +++Y Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIY 43 Score = 20.6 bits (41), Expect(2) = 1e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 30 QAVQVFGRK 56 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 63.3 bits (147), Expect = 2e-10 Identities = 27/38 (71%), Positives = 28/38 (73%) Frame = +2 Query: 611 LQFHWPSFLQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 + HWPS LQRRDWE PGVTQLNRLA P A W NSE Sbjct: 280 ITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 317 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 58.4 bits (135), Expect = 7e-09 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = +2 Query: 611 LQFHWPSFLQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 + HWPSF +RRDWE PGV QLNRLA P A W +SE Sbjct: 25 ITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASWRSSE 62 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.4 bits (130), Expect = 3e-08 Identities = 29/46 (63%), Positives = 29/46 (63%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCKNDGQ*NCNTTHXRANW 586 SLL Q AK G ARRLSWVTPGF K NCNTTH RANW Sbjct: 36 SLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPV-NCNTTHYRANW 80 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 56.0 bits (129), Expect = 4e-08 Identities = 31/55 (56%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCKN--DGQ*NCNTTHXRANWVTGPPHR 565 SLL Q AK G ARRLSWVTPGFSQSRRCK + C R + +T PP R Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPMTIPPAR 69 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 55.6 bits (128), Expect = 5e-08 Identities = 32/65 (49%), Positives = 34/65 (52%) Frame = -3 Query: 828 LTGNFXKIINX*KXAQSPNXXGQXFWERXIGCGPXSLLPQXAKRGIXARRLSWVTPGFSQ 649 L G + N K A + WE SLL Q AK G ARRLSWVTPGFSQ Sbjct: 200 LDGGYKNFFNTCKGASHSPFRLRNCWEGR-SVRASSLLRQLAKGGCAARRLSWVTPGFSQ 258 Query: 648 SRRCK 634 SRRCK Sbjct: 259 SRRCK 263 >SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 54.8 bits (126), Expect = 9e-08 Identities = 29/55 (52%), Positives = 33/55 (60%), Gaps = 2/55 (3%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCKN--DGQ*NCNTTHXRANWVTGPPHR 565 SLL Q AK G ARRLSWVTPGFSQSRRCK + C R + + GP + Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPICGPTQK 69 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = +2 Query: 635 LQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 LQRRDWE PGVTQLNRLA P A WGNSE Sbjct: 71 LQRRDWENPGVTQLNRLAAHPPFASWGNSE 100 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/30 (80%), Positives = 24/30 (80%) Frame = +2 Query: 635 LQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 LQRRDWE PGVTQLNRLA P A WGNSE Sbjct: 135 LQRRDWENPGVTQLNRLAAHPPFASWGNSE 164 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 54.0 bits (124), Expect = 1e-07 Identities = 26/37 (70%), Positives = 26/37 (70%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCKNDGQ*NC 613 SLL Q AK G ARRLSWVTPGFSQSRRCK C Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASELC 58 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 490 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 519 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 160 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 189 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 237 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 266 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 381 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 410 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 83 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 664 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 693 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 902 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 931 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 14 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 43 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 389 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 418 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 238 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 267 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 305 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 334 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 573 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 602 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 420 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 449 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 371 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 400 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 197 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 226 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 635 LQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 LQRRDWE GVTQLNRLA P A W NSE Sbjct: 519 LQRRDWENTGVTQLNRLAAHPPFASWRNSE 548 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 47 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 76 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 803 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 832 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 63 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 92 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 464 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 493 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 83 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 Score = 51.2 bits (117), Expect = 1e-06 Identities = 23/30 (76%), Positives = 23/30 (76%) Frame = +2 Query: 635 LQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 LQRRDWE PGVTQLNRLA P A W NSE Sbjct: 89 LQRRDWENPGVTQLNRLAAHPPFASWRNSE 118 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 385 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 414 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 1119 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 1148 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 310 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 339 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 124 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 153 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 34 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 63 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 37 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 45 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 74 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 50 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 79 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 281 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 310 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 500 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 529 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 265 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 294 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +2 Query: 632 FLQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 FLQRRDWE PGVTQLNRLA P A W NSE Sbjct: 68 FLQRRDWENPGVTQLNRLAAHPPFASWRNSE 98 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 108 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 137 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 68 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 97 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 70 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 99 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 544 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 573 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 64 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 93 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 169 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 198 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 254 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 283 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 279 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 308 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +2 Query: 632 FLQRRDWEXPGVTQLNRLAXIPLLAXWGNSE 724 FLQRRDWE PGVTQLNRLA P A W NSE Sbjct: 11 FLQRRDWENPGVTQLNRLAAHPPFASWRNSE 41 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 52 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 81 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 206 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 235 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 142 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 171 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 463 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 492 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 113 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 142 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 69 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 98 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 132 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 161 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 298 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 327 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 37 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 29 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 8 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 37 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 148 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 177 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 22 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 51 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 126 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 155 >SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 1867 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 1896 >SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 932 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 961 >SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 15 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 53.6 bits (123), Expect = 2e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = -3 Query: 723 SLLPQXAKRGIXARRLSWVTPGFSQSRRCK 634 SLL Q AK G ARRLSWVTPGFSQSRRCK Sbjct: 37 SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,208,496 Number of Sequences: 59808 Number of extensions: 497091 Number of successful extensions: 5421 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3794 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5393 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2455286845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -