BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30395.Seq (819 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) 73 4e-13 >SB_25798| Best HMM Match : FA_desaturase (HMM E-Value=0) Length = 268 Score = 72.5 bits (170), Expect = 4e-13 Identities = 34/68 (50%), Positives = 43/68 (63%) Frame = +1 Query: 478 SFTGQSKSHPWVRDHRVHHKYSDTDADPHNASRGLFYSHIXXVVRQKTP*S*EGKGN**T 657 S Q+ W RDHRVHHKYS+TDADPHNA RG F+SH+ ++++K P KG Sbjct: 48 SMAAQNDIFEWSRDHRVHHKYSETDADPHNAKRGFFFSHVGWLMQRKHP-DVIRKGKGID 106 Query: 658 FSDLFRKS 681 SDL+ S Sbjct: 107 LSDLYADS 114 Score = 59.3 bits (137), Expect = 4e-09 Identities = 30/80 (37%), Positives = 44/80 (55%), Gaps = 1/80 (1%) Frame = +2 Query: 395 GVTAGAHRLWSHKSYKARLPLQILLMVFLSLANQRATHGFETIESITSTAIRTQIHITQA 574 GVT GAHRLW+H+++KA+ PL++++M+ S+A Q + + T A Sbjct: 19 GVTIGAHRLWAHRTFKAKWPLRLVIMLMNSMAAQNDIFEWSRDHRVHHKYSETDADPHNA 78 Query: 575 V-GSFILIXGWLFVRKHPEV 631 G F GWL RKHP+V Sbjct: 79 KRGFFFSHVGWLMQRKHPDV 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,051,011 Number of Sequences: 59808 Number of extensions: 546133 Number of successful extensions: 1034 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 961 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1032 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -