BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30394.Seq (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) 116 2e-26 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 6e-12 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 58 6e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 6e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 3e-08 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 53 3e-07 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 46 3e-05 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 40 0.002 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 40 0.002 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 40 0.002 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 38 0.012 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) 35 0.084 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.20 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 33 0.34 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 31 0.79 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 31 1.4 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 31 1.4 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 31 1.4 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 30 1.8 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 30 1.8 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 30 1.8 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 30 1.8 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 30 1.8 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 30 1.8 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 30 1.8 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 30 1.8 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 30 1.8 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 30 1.8 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 30 1.8 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 30 1.8 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 30 1.8 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 30 1.8 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 30 1.8 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 30 1.8 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 1.8 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 30 1.8 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 30 1.8 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 30 1.8 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 30 1.8 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 30 1.8 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 30 1.8 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 30 1.8 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 30 1.8 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 30 1.8 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 30 1.8 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 30 1.8 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 30 1.8 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 30 1.8 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 30 1.8 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 30 1.8 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 30 1.8 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 30 1.8 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 30 1.8 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 30 1.8 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 30 1.8 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 30 1.8 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 30 1.8 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 30 1.8 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 30 1.8 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 30 1.8 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 30 1.8 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 30 1.8 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 30 1.8 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 30 1.8 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 30 1.8 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 30 1.8 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 30 1.8 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 30 1.8 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 30 1.8 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 30 1.8 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 30 1.8 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 30 1.8 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 30 1.8 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 30 1.8 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 30 1.8 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 30 1.8 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 30 1.8 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 30 1.8 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 30 1.8 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 30 1.8 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 30 1.8 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 30 1.8 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 30 1.8 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 30 1.8 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 30 1.8 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 30 1.8 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 30 1.8 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 30 1.8 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 30 1.8 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 30 1.8 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 30 1.8 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 30 1.8 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 30 1.8 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 30 1.8 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 30 1.8 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 30 1.8 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 30 1.8 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 30 1.8 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 30 1.8 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 30 1.8 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 30 1.8 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.4 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 29 5.5 SB_51749| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_51748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.7 >SB_47363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 116 bits (279), Expect = 2e-26 Identities = 54/63 (85%), Positives = 59/63 (93%) Frame = +2 Query: 257 IRQAISKALIAFYQKYVDEASKKEIKDILVQYDRSLLVAXPRRCEPKKFGGPGARARYQK 436 IRQAISK+L+A+YQKYVDE SKKEI+DILVQYDRSLLVA PRR E KKFGGPGAR+RYQK Sbjct: 45 IRQAISKSLVAYYQKYVDEVSKKEIRDILVQYDRSLLVADPRRTEAKKFGGPGARSRYQK 104 Query: 437 SYR 445 SYR Sbjct: 105 SYR 107 Score = 50.0 bits (114), Expect(2) = 1e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +3 Query: 156 KLQEPILLLGKEKFSMVXIRXTVKGGGHVAQVY 254 K++EPILLLGKE+F V IR VKGGGH +++Y Sbjct: 11 KVEEPILLLGKERFEGVDIRVRVKGGGHTSRIY 43 Score = 20.6 bits (41), Expect(2) = 1e-06 Identities = 8/9 (88%), Positives = 9/9 (100%) Frame = +3 Query: 30 QAVQVFGRK 56 Q+VQVFGRK Sbjct: 3 QSVQVFGRK 11 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 68.5 bits (160), Expect = 6e-12 Identities = 39/63 (61%), Positives = 41/63 (65%) Frame = -1 Query: 773 CATFGKGXIXXGPLFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYR 594 CAT GKG LFAITP RG C KAIKLGN +GFP S + PVNCNTTHYR Sbjct: 2 CATVGKGDRCG--LFAITPA-GERGMCC-KAIKLGNAKGFP-SHDVVKRRPVNCNTTHYR 56 Query: 593 ANW 585 ANW Sbjct: 57 ANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 58.4 bits (135), Expect = 6e-09 Identities = 32/50 (64%), Positives = 33/50 (66%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 LFAITP RG C KAIKLGN FP S + PVNCNTTHYRANW Sbjct: 7 LFAITPA-GERGMCC-KAIKLGNASVFP-SHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 58.4 bits (135), Expect = 6e-09 Identities = 32/50 (64%), Positives = 33/50 (66%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 LFAITP RG C KAIKLGN FP S + PVNCNTTHYRANW Sbjct: 21 LFAITPA-GERGMCC-KAIKLGNASVFP-SHDVVKRRPVNCNTTHYRANW 67 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 56.0 bits (129), Expect = 3e-08 Identities = 32/49 (65%), Positives = 33/49 (67%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRAN 588 LFAITP RG C KAIKLGN +GFP S PVNCNTTHYRAN Sbjct: 52 LFAITPA-GERGMCC-KAIKLGNARGFP-SHDGEKRRPVNCNTTHYRAN 97 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/50 (56%), Positives = 32/50 (64%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 LFAITP +G+ +KLG QGFP S + PVNCNTTHYRANW Sbjct: 55 LFAITPA-GEKGDVLQGDLKLGKRQGFP-SHDVVKRRPVNCNTTHYRANW 102 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 52.8 bits (121), Expect = 3e-07 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 LFAITP RG C K+IKL + FP S + PVNCNTTHYRANW Sbjct: 15 LFAITPA-GERGMCC-KSIKLAHASVFP-SHDVVKRRPVNCNTTHYRANW 61 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 51.6 bits (118), Expect = 7e-07 Identities = 31/50 (62%), Positives = 32/50 (64%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 LFAITP RG C KAIKL P FP S + PVNCNTTHYRANW Sbjct: 1854 LFAITPA-GERGMCC-KAIKLVTPV-FP-SHDVVKRRPVNCNTTHYRANW 1899 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 46.0 bits (104), Expect = 3e-05 Identities = 27/45 (60%), Positives = 27/45 (60%) Frame = +3 Query: 570 GGARYPIRPIVXRITIHWAVVLQRP*LGKTLGVTQLNXLXXTFPP 704 GGA PIRPIV RITIHW P GKTL TQLN L PP Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAP-TGKTLAYTQLNRL-AAHPP 76 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 46.0 bits (104), Expect = 3e-05 Identities = 25/41 (60%), Positives = 27/41 (65%) Frame = -1 Query: 710 AXRGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRAN 588 A RG C KAIKLGN F +S + PVNCNTTHYRAN Sbjct: 2 AERGMCC-KAIKLGNASVF-RSHDVVKRRPVNCNTTHYRAN 40 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/40 (52%), Positives = 25/40 (62%) Frame = -1 Query: 704 RGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 +G CA + + P GFP S + PVNCNTTHYRANW Sbjct: 43 KGGCAARRLSWVTP-GFP-SHDVVKRRPVNCNTTHYRANW 80 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 42.7 bits (96), Expect = 3e-04 Identities = 28/50 (56%), Positives = 29/50 (58%) Frame = -2 Query: 772 AQLLGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 AQLLGKG GP W KG +V QR LSWVTP F RCKTTA Sbjct: 2 AQLLGKGDRC-GPLRYYAS-WRKG-DVLQRRLSWVTPG-FSQSRRCKTTA 47 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -1 Query: 704 RGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 +G CA + + G P S + PVNCNTTHYRANW Sbjct: 614 KGGCAARRLSWGFP-----SHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -1 Query: 704 RGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 +G CA + + G P S + PVNCNTTHYRANW Sbjct: 57 KGGCAARRLSWGFP-----SHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/40 (47%), Positives = 23/40 (57%) Frame = -1 Query: 704 RGECAXKAIKLGNPQGFPQSRTL*NDGPVNCNTTHYRANW 585 +G CA + + G P S + PVNCNTTHYRANW Sbjct: 57 KGGCAARRLSWGFP-----SHDVVKRRPVNCNTTHYRANW 91 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 659 GFPQSRTL*NDGPVNCNTTHYRANW 585 GFP S + PVNCNTTHYRANW Sbjct: 1 GFP-SHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 659 GFPQSRTL*NDGPVNCNTTHYRANW 585 GFP S + PVNCNTTHYRANW Sbjct: 57 GFP-SHDVVKRRPVNCNTTHYRANW 80 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 623 PVNCNTTHYRANW 585 PVNCNTTHYRANW Sbjct: 9 PVNCNTTHYRANW 21 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 623 PVNCNTTHYRANW 585 PVNCNTTHYRANW Sbjct: 47 PVNCNTTHYRANW 59 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.5 bits (83), Expect = 0.012 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -1 Query: 623 PVNCNTTHYRANW 585 PVNCNTTHYRANW Sbjct: 9 PVNCNTTHYRANW 21 >SB_228| Best HMM Match : SAM_1 (HMM E-Value=10) Length = 119 Score = 34.7 bits (76), Expect = 0.084 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 233 WSCSTSLPIRQAIS-KALIAFYQKYVDEASKKEIKDILVQYDRSLLVAXPRRCE 391 W + L ++ ++AF QKY+D +KE +Q+ + +LV+ R CE Sbjct: 36 WDRALELAVKHKTHVDTVLAFRQKYLDNFGRKETSKRFLQFAQGVLVSLARECE 89 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 33.9 bits (74), Expect = 0.15 Identities = 25/50 (50%), Positives = 27/50 (54%) Frame = -2 Query: 772 AQLLGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 A L +G SV S L KGG +R LSWVTP VF RCKTTA Sbjct: 1 AAQLWEGRSVRA--SSLLRQLAKGGCAARR-LSWVTP-VFSQSRRCKTTA 46 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -2 Query: 712 WPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 W KGG +R LSWVTP F RCKTTA Sbjct: 80 WRKGGCAARR-LSWVTPG-FSQSRRCKTTA 107 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 33.5 bits (73), Expect = 0.20 Identities = 23/47 (48%), Positives = 25/47 (53%) Frame = -2 Query: 763 LGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 +GKG GP W KG +V Q LSWVTP F RCKTTA Sbjct: 5 VGKGDRC-GPLRYYAS-WRKG-DVLQGRLSWVTPG-FSQSRRCKTTA 47 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 32.7 bits (71), Expect = 0.34 Identities = 23/46 (50%), Positives = 25/46 (54%) Frame = -2 Query: 760 GKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 G+G SV S L KGG +R LSWVTP F RCKTTA Sbjct: 54 GEGRSVRA--SSLLRQLAKGGCAARR-LSWVTPG-FSQSRRCKTTA 95 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 32.7 bits (71), Expect = 0.34 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = -2 Query: 772 AQLLGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 AQLL +G SV S L KGG +R LSWVTP F RCKTTA Sbjct: 17 AQLL-EGRSVRA--SSLLRQLAKGGCAARR-LSWVTPG-FSQSRRCKTTA 61 >SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.34 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP VF RCKTTA Sbjct: 22 KGGCAARR-LSWVTP-VFSQSRRCKTTA 47 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 32.3 bits (70), Expect = 0.45 Identities = 24/56 (42%), Positives = 27/56 (48%) Frame = +3 Query: 588 IRPIVXRITIHWAVVLQRP*LGKTLGVTQLNXLXXTFPPXGXXGXNXEKGPXTDXP 755 IRPIV RITIHW +R + GV QLN L PP + E TD P Sbjct: 18 IRPIVSRITIHWPSFYKRR-DWENPGVNQLNRL-AAHPPFASWRSSEE--ARTDRP 69 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 31.5 bits (68), Expect = 0.79 Identities = 24/50 (48%), Positives = 26/50 (52%) Frame = -2 Query: 772 AQLLGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 A L +G SV S L KGG +R LSWVTP F RCKTTA Sbjct: 1 AAQLWEGRSVRA--SSLLRQLAKGGCAARR-LSWVTPG-FSQSRRCKTTA 46 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 31.5 bits (68), Expect = 0.79 Identities = 24/50 (48%), Positives = 26/50 (52%) Frame = -2 Query: 772 AQLLGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 A L +G SV S L KGG +R LSWVTP F RCKTTA Sbjct: 16 AAQLWEGRSVRA--SSLLRQLAKGGCAARR-LSWVTPG-FSQSRRCKTTA 61 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +1 Query: 625 PSFYNVRDWGKPWGLPNLXAFXAHSP 702 PSFYNV GK LPNL A AH P Sbjct: 9 PSFYNVVT-GKTLALPNLIALAAHPP 33 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.79 Identities = 24/50 (48%), Positives = 26/50 (52%) Frame = -2 Query: 772 AQLLGKGXSVXGPFSXLXPXWPKGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 A L +G SV S L KGG +R LSWVTP F RCKTTA Sbjct: 16 AAQLWEGRSVRA--SSLLRQLAKGGCAARR-LSWVTPG-FSQSRRCKTTA 61 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 31.5 bits (68), Expect = 0.79 Identities = 18/28 (64%), Positives = 19/28 (67%) Frame = -1 Query: 734 LFAITPXXAXRGECAXKAIKLGNPQGFP 651 LFAITP RG C KAIKLGN + FP Sbjct: 28 LFAITPA-GERGMCC-KAIKLGNARVFP 53 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTAQ 620 KGG +R LSWVTP F RCKTTA+ Sbjct: 204 KGGCAARR-LSWVTPG-FSQSRRCKTTAK 230 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/50 (46%), Positives = 25/50 (50%) Frame = +3 Query: 606 RITIHWAVVLQRP*LGKTLGVTQLNXLXXTFPPXGXXGXNXEKGPXTDXP 755 RITIHW VLQR + GVTQLN L PP + E TD P Sbjct: 279 RITIHWPSVLQRR-DWENPGVTQLNRL-AAHPPFASWRNSEE--ARTDRP 324 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTAQ 620 KGG +R LSWVTP F RCKTTA+ Sbjct: 1874 KGGCAARR-LSWVTPG-FSQSRRCKTTAK 1900 >SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) Length = 629 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTAQ 620 KGG +R LSWVTP F RCKTTA+ Sbjct: 484 KGGCAARR-LSWVTPG-FSQSRRCKTTAR 510 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 30.7 bits (66), Expect = 1.4 Identities = 24/50 (48%), Positives = 24/50 (48%) Frame = +3 Query: 606 RITIHWAVVLQRP*LGKTLGVTQLNXLXXTFPPXGXXGXNXEKGPXTDXP 755 RITIHW L KT GVTQLN L PP N EK TD P Sbjct: 3 RITIHWPSFYNVM-LAKTPGVTQLNRL-AAHPPFASW-RNSEKA-RTDRP 48 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 497 KGGCAARR-LSWVTPG-FSQSRRCKTTA 522 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 167 KGGCAARR-LSWVTPG-FSQSRRCKTTA 192 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 29 KGGCAARR-LSWVTPG-FSQSRRCKTTA 54 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 244 KGGCAARR-LSWVTPG-FSQSRRCKTTA 269 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 388 KGGCAARR-LSWVTPG-FSQSRRCKTTA 413 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 241 KGGCAARR-LSWVTPG-FSQSRRCKTTA 266 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 90 KGGCAARR-LSWVTPG-FSQSRRCKTTA 115 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +3 Query: 570 GGARYPIRPIVXRITIHW 623 GGA PIRPIV ITIHW Sbjct: 38 GGA--PIRPIVSHITIHW 53 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 671 KGGCAARR-LSWVTPG-FSQSRRCKTTA 696 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 909 KGGCAARR-LSWVTPG-FSQSRRCKTTA 934 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 177 KGGCAARR-LSWVTPG-FSQSRRCKTTA 202 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 396 KGGCAARR-LSWVTPG-FSQSRRCKTTA 421 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 245 KGGCAARR-LSWVTPG-FSQSRRCKTTA 270 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 312 KGGCAARR-LSWVTPG-FSQSRRCKTTA 337 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 580 KGGCAARR-LSWVTPG-FSQSRRCKTTA 605 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 427 KGGCAARR-LSWVTPG-FSQSRRCKTTA 452 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 378 KGGCAARR-LSWVTPG-FSQSRRCKTTA 403 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 54 KGGCAARR-LSWVTPG-FSQSRRCKTTA 79 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 810 KGGCAARR-LSWVTPG-FSQSRRCKTTA 835 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 471 KGGCAARR-LSWVTPG-FSQSRRCKTTA 496 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 90 KGGCAARR-LSWVTPG-FSQSRRCKTTA 115 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 29 KGGCAARR-LSWVTPG-FSQSRRCKTTA 54 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 29 KGGCAARR-LSWVTPG-FSQSRRCKTTA 54 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 392 KGGCAARR-LSWVTPG-FSQSRRCKTTA 417 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 29 KGGCAARR-LSWVTPG-FSQSRRCKTTA 54 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 1126 KGGCAARR-LSWVTPG-FSQSRRCKTTA 1151 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 317 KGGCAARR-LSWVTPG-FSQSRRCKTTA 342 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 131 KGGCAARR-LSWVTPG-FSQSRRCKTTA 156 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 41 KGGCAARR-LSWVTPG-FSQSRRCKTTA 66 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 3 KGGCAARR-LSWVTPG-FSQSRRCKTTA 28 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 15 KGGCAARR-LSWVTPG-FSQSRRCKTTA 40 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 29 KGGCAARR-LSWVTPG-FSQSRRCKTTA 54 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 52 KGGCAARR-LSWVTPG-FSQSRRCKTTA 77 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 57 KGGCAARR-LSWVTPG-FSQSRRCKTTA 82 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 288 KGGCAARR-LSWVTPG-FSQSRRCKTTA 313 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 507 KGGCAARR-LSWVTPG-FSQSRRCKTTA 532 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 272 KGGCAARR-LSWVTPG-FSQSRRCKTTA 297 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 115 KGGCAARR-LSWVTPG-FSQSRRCKTTA 140 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 75 KGGCAARR-LSWVTPG-FSQSRRCKTTA 100 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 77 KGGCAARR-LSWVTPG-FSQSRRCKTTA 102 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 551 KGGCAARR-LSWVTPG-FSQSRRCKTTA 576 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 71 KGGCAARR-LSWVTPG-FSQSRRCKTTA 96 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 176 KGGCAARR-LSWVTPG-FSQSRRCKTTA 201 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 36 KGGCAARR-LSWVTPG-FSQSRRCKTTA 61 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 261 KGGCAARR-LSWVTPG-FSQSRRCKTTA 286 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 286 KGGCAARR-LSWVTPG-FSQSRRCKTTA 311 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) Length = 446 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 59 KGGCAARR-LSWVTPG-FSQSRRCKTTA 84 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 213 KGGCAARR-LSWVTPG-FSQSRRCKTTA 238 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 149 KGGCAARR-LSWVTPG-FSQSRRCKTTA 174 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 470 KGGCAARR-LSWVTPG-FSQSRRCKTTA 495 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 120 KGGCAARR-LSWVTPG-FSQSRRCKTTA 145 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 76 KGGCAARR-LSWVTPG-FSQSRRCKTTA 101 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 139 KGGCAARR-LSWVTPG-FSQSRRCKTTA 164 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 305 KGGCAARR-LSWVTPG-FSQSRRCKTTA 330 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 15 KGGCAARR-LSWVTPG-FSQSRRCKTTA 40 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 15 KGGCAARR-LSWVTPG-FSQSRRCKTTA 40 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 155 KGGCAARR-LSWVTPG-FSQSRRCKTTA 180 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 29 KGGCAARR-LSWVTPG-FSQSRRCKTTA 54 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 348 KGGCAARR-LSWVTPG-FSQSRRCKTTA 373 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 44 KGGCAARR-LSWVTPG-FSQSRRCKTTA 69 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = -2 Query: 706 KGGNVXQRXLSWVTPRVFPSHGRCKTTA 623 KGG +R LSWVTP F RCKTTA Sbjct: 22 KGGCAARR-LSWVTPG-FSQSRRCKTTA 47 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,048,641 Number of Sequences: 59808 Number of extensions: 431482 Number of successful extensions: 1096 Number of sequences better than 10.0: 382 Number of HSP's better than 10.0 without gapping: 1058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1088 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -