BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30390.Seq (832 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) 46 5e-05 SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.16 >SB_55147| Best HMM Match : TPR_2 (HMM E-Value=1.8e-10) Length = 559 Score = 45.6 bits (103), Expect = 5e-05 Identities = 26/73 (35%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Frame = +1 Query: 508 LKLNKPNACIKDCTHALELNCDSACLTNSEG---EHIGSWVN-XKNLPTILVNL*RFDYD 675 +++ KPNA I+DC A ++N DSA + G E +G W K+L L + D+D Sbjct: 93 IRMKKPNAAIRDCDKAAQINPDSAQIYKWRGRAHEFLGHWEKADKDLAQAL----KLDFD 148 Query: 676 VPTNEWLNEVKTK 714 NEW +V K Sbjct: 149 EQVNEWFKDVHPK 161 Score = 38.3 bits (85), Expect = 0.008 Identities = 30/91 (32%), Positives = 38/91 (41%), Gaps = 7/91 (7%) Frame = +2 Query: 257 EPESD---VELDMEGVIAPDQTDESQDMGDPNXXXXXXXXXXXXXXXXXAMRAFSEQ--- 418 +PES+ ++D GVI PD DE MGD + Sbjct: 3 KPESEKGVFDIDQTGVIEPD-VDEPVPMGDDSIESPLASLVMTFWLSVTGREKSGGSDTL 61 Query: 419 -KYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 +EAI L+T AI NP SA LFAKR + Sbjct: 62 GNLEEAIKLFTDAIMKNPHSAPLFAKRASCF 92 >SB_42562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 404 AFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQV 505 AF +QKY+EA+ LYT A+ + + + R Q+ Sbjct: 130 AFKQQKYEEAVKLYTQALNQDRTNTAFYTNRAQL 163 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,053,911 Number of Sequences: 59808 Number of extensions: 465970 Number of successful extensions: 983 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 980 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -