BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30390.Seq (832 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to te... 63 3e-10 At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containi... 55 7e-08 At4g23570.2 68417.m03396 phosphatase-related low similarity to p... 38 0.008 At4g23570.1 68417.m03395 phosphatase-related low similarity to p... 38 0.008 At2g42810.1 68415.m05300 serine/threonine protein phosphatase, p... 36 0.025 At4g11260.1 68417.m01822 phosphatase-related low similarity to p... 36 0.033 At1g12270.1 68414.m01419 stress-inducible protein, putative simi... 35 0.076 At1g62740.1 68414.m07081 stress-inducible protein, putative simi... 34 0.10 At4g12400.1 68417.m01960 stress-inducible protein, putative simi... 34 0.13 At1g56440.1 68414.m06491 serine/threonine protein phosphatase-re... 31 0.94 At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containi... 31 1.2 At4g30480.1 68417.m04327 tetratricopeptide repeat (TPR)-containi... 31 1.2 At1g68185.1 68414.m07789 ubiquitin-related similar to ubiquitin-... 31 1.2 At5g09420.1 68418.m01091 chloroplast outer membrane translocon s... 30 2.2 At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containi... 28 6.6 At1g01740.1 68414.m00093 protein kinase family protein low simil... 28 6.6 At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containi... 28 8.7 >At3g17880.1 68416.m02278 tetratricoredoxin (TDX) identical to tetratricoredoxin [Arabidopsis thaliana] GI:18041544; similar to SP|Q42443 Thioredoxin H-type (TRX-H) (Phloem sap 13 kDa protein-1) {Oryza sativa}; contains Pfam profile: PF00085 Thioredoxin Length = 380 Score = 62.9 bits (146), Expect = 3e-10 Identities = 34/82 (41%), Positives = 43/82 (52%) Frame = +2 Query: 263 ESDVELDMEGVIAPDQTDESQDMGDPNXXXXXXXXXXXXXXXXXAMRAFSEQKYDEAINL 442 ESDVELD V+ PD + Q MGDP AM A S+ ++DEAI Sbjct: 76 ESDVELDNSDVVEPDN-EPPQPMGDPTAEVTDENRDDAQSEKSKAMEAISDGRFDEAIEH 134 Query: 443 YTAAIQLNPQSALLFAKRGQVY 508 T A+ LNP SA+L+A R V+ Sbjct: 135 LTKAVMLNPTSAILYATRASVF 156 Score = 48.4 bits (110), Expect = 6e-06 Identities = 22/51 (43%), Positives = 31/51 (60%) Frame = +3 Query: 39 NAEQLDQLKSFVEICKTQPQLLHHPQLAFFKDYLISLGVSLPTATFGAKDF 191 +A Q+ +L+ FVE K P +LH P L FFK+YL SLG +P +D+ Sbjct: 3 DAIQVAELRRFVEQLKLNPSILHDPSLVFFKEYLRSLGAQVPKIEKTERDY 53 Score = 33.1 bits (72), Expect = 0.23 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%) Frame = +1 Query: 508 LKLNKPNACIKDCTHALELNCDSACLTNSEG---EHIGSW 618 LK+ KPNA I+D AL+ N DSA S G +G W Sbjct: 157 LKVKKPNAAIRDANVALQFNSDSAKGYKSRGMAKAMLGQW 196 >At4g22670.1 68417.m03272 tetratricopeptide repeat (TPR)-containing protein similar to Hsc70-interacting protein (Hip) from {Homo sapiens} SP|P50502, {Rattus norvegicus} SP|P50503; contains Pfam profile PF00515: tetratricopeptide repeat (TPR) domain Length = 441 Score = 54.8 bits (126), Expect = 7e-08 Identities = 33/82 (40%), Positives = 41/82 (50%) Frame = +2 Query: 263 ESDVELDMEGVIAPDQTDESQDMGDPNXXXXXXXXXXXXXXXXXAMRAFSEQKYDEAINL 442 ESDVEL+ + + PD D Q MGD + AM A SE +DEAI Sbjct: 88 ESDVELEGD-TVEPDN-DPPQKMGDSSVEVTDENREAAQEAKGKAMEALSEGNFDEAIEH 145 Query: 443 YTAAIQLNPQSALLFAKRGQVY 508 T AI LNP SA+++ R VY Sbjct: 146 LTRAITLNPTSAIMYGNRASVY 167 Score = 51.2 bits (117), Expect = 8e-07 Identities = 21/43 (48%), Positives = 31/43 (72%) Frame = +3 Query: 39 NAEQLDQLKSFVEICKTQPQLLHHPQLAFFKDYLISLGVSLPT 167 ++ +L +LK F++ CK+ P LL P L+FF+DYL SLG +PT Sbjct: 2 DSTKLSELKVFIDQCKSDPSLLTTPSLSFFRDYLESLGAKIPT 44 Score = 35.1 bits (77), Expect = 0.058 Identities = 19/40 (47%), Positives = 23/40 (57%), Gaps = 3/40 (7%) Frame = +1 Query: 508 LKLNKPNACIKDCTHALELNCDSACLTNSEG---EHIGSW 618 +KL KPNA I+D ALE+N DSA S G +G W Sbjct: 168 IKLKKPNAAIRDANAALEINPDSAKGYKSRGMARAMLGEW 207 >At4g23570.2 68417.m03396 phosphatase-related low similarity to phosphoprotein phosphatase [Mus musculus] GI:567040; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 350 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +2 Query: 395 AMRAFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 A AF + +D A++LY+ AI L+P A FA R Q Y Sbjct: 9 AKEAFVDDDFDVAVDLYSKAIDLDPNCAEFFADRAQAY 46 >At4g23570.1 68417.m03395 phosphatase-related low similarity to phosphoprotein phosphatase [Mus musculus] GI:567040; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 350 Score = 37.9 bits (84), Expect = 0.008 Identities = 17/38 (44%), Positives = 23/38 (60%) Frame = +2 Query: 395 AMRAFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 A AF + +D A++LY+ AI L+P A FA R Q Y Sbjct: 9 AKEAFVDDDFDVAVDLYSKAIDLDPNCAEFFADRAQAY 46 >At2g42810.1 68415.m05300 serine/threonine protein phosphatase, putative similar to SP|P53042 Serine/threonine protein phosphatase 5 (EC 3.1.3.16) (PP5) (Protein phosphatase T) (PPT) {Rattus norvegicus}; contains Pfam profiles PF00149: Ser/Thr protein phosphatase, PF00515: TPR Domain Length = 484 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +2 Query: 395 AMRAFSEQKYDEAINLYTAAIQLNPQSALLFAKR 496 A AF KY AI+LYT AI+LN +A+ +A R Sbjct: 20 ANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANR 53 >At4g11260.1 68417.m01822 phosphatase-related low similarity to protein phosphatase T [Saccharomyces cerevisiae] GI:897806; contains Pfam profiles PF00515: TPR Domain, PF05002: SGS domain, PF04969: CS domain Length = 358 Score = 35.9 bits (79), Expect = 0.033 Identities = 16/36 (44%), Positives = 22/36 (61%) Frame = +2 Query: 395 AMRAFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQ 502 A AF + +D A++LY+ AI L+P A FA R Q Sbjct: 9 AKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQ 44 >At1g12270.1 68414.m01419 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 572 Score = 34.7 bits (76), Expect = 0.076 Identities = 16/34 (47%), Positives = 19/34 (55%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 F EQKY EAI YT AI+ NP ++ R Y Sbjct: 394 FKEQKYPEAIKHYTEAIKRNPNDHKAYSNRAASY 427 Score = 29.1 bits (62), Expect = 3.8 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 404 AFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 AFS + AIN +T AI L P + +LF+ R + Sbjct: 12 AFSSGDFTTAINHFTEAIALAPTNHVLFSNRSAAH 46 >At1g62740.1 68414.m07081 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 571 Score = 34.3 bits (75), Expect = 0.10 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 F EQKY +A+ YT AI+ NP+ ++ R Y Sbjct: 393 FKEQKYPDAVRHYTEAIKRNPKDPRAYSNRAACY 426 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 404 AFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 AFS ++ A+N +T AI L P + +LF+ R + Sbjct: 12 AFSSGDFNSAVNHFTDAINLTPTNHVLFSNRSAAH 46 >At4g12400.1 68417.m01960 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 530 Score = 33.9 bits (74), Expect = 0.13 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 F EQKY EA+ Y+ AI+ NP ++ R Y Sbjct: 380 FKEQKYPEAVKHYSEAIKRNPNDVRAYSNRAACY 413 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +2 Query: 404 AFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 AFS Y AI +T AI L+P + +L++ R Y Sbjct: 12 AFSSGDYATAITHFTEAINLSPTNHILYSNRSASY 46 >At1g56440.1 68414.m06491 serine/threonine protein phosphatase-related similar to SP|Q60676 Serine/threonine protein phosphatase 5 (EC 3.1.3.16) (PP5) (Protein phosphatase T) (PPT) Mus musculus, Tetratricopeptide Repeats Of Protein Phosphatase 5 [Homo sapiens] GI:3212250; contains Pfam profile: PF00515: TPR Domain Length = 476 Score = 31.1 bits (67), Expect = 0.94 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 F ++K++EAI+ Y+ +I L+P +A+ +A R Y Sbjct: 95 FKQKKFNEAIDCYSRSIALSP-NAVTYANRAMAY 127 >At4g30480.2 68417.m04328 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 277 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 463 KSTECFVVC*TGTGV--LKLNKPNACIKDCTHALELN 567 +S E +C GV LKL K IK+CT ALELN Sbjct: 140 ESIELRSICYLNRGVCFLKLGKCEETIKECTKALELN 176 >At4g30480.1 68417.m04327 tetratricopeptide repeat (TPR)-containing protein similar to SP|Q99614 Tetratricopeptide repeat protein 1 {Homo sapiens}; contains Pfam profile PF00515: TPR Domain Length = 208 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = +1 Query: 463 KSTECFVVC*TGTGV--LKLNKPNACIKDCTHALELN 567 +S E +C GV LKL K IK+CT ALELN Sbjct: 140 ESIELRSICYLNRGVCFLKLGKCEETIKECTKALELN 176 >At1g68185.1 68414.m07789 ubiquitin-related similar to ubiquitin-like protein smt3/pmt3 SP:O13351 from [Fission yeast] Length = 215 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/74 (21%), Positives = 31/74 (41%) Frame = +2 Query: 254 KEPESDVELDMEGVIAPDQTDESQDMGDPNXXXXXXXXXXXXXXXXXAMRAFSEQKYDEA 433 +E E + ++E P +Q +P +R F+++K++ Sbjct: 108 QEVEESAKREVEESRNPSSETAAQLPSEPTNDRAKIVITIQDKDGQKTLRVFADEKFERV 167 Query: 434 INLYTAAIQLNPQS 475 I LYT +L+PQ+ Sbjct: 168 IKLYTDKAKLDPQN 181 >At5g09420.1 68418.m01091 chloroplast outer membrane translocon subunit, putative similar to component of chloroplast outer membrane translocon Toc64 [Pisum sativum] GI:7453538; contains Pfam profiles PF01425: Amidase, PF00515: TPR Domain Length = 603 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 404 AFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 A+ +++++A+N YT AI+LN +A + R + Sbjct: 498 AYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAF 532 >At4g08320.1 68417.m01373 tetratricopeptide repeat (TPR)-containing protein glutamine-rich tetratricopeptide repeat (TPR) containing protein (SGT) - Rattus norvegicus,PID:e1285298 (SP|O70593); contains Pfam profile PF00515 TPR Domain Length = 426 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 401 RAFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 +A Y EA+ LY+ AI L ++A+ + R Y Sbjct: 184 KAMQSNLYLEAVELYSFAIALTDKNAVFYCNRAAAY 219 >At1g01740.1 68414.m00093 protein kinase family protein low similarity to protein kinase [Arabidopsis thaliana] GI:2852449; contains Pfam profile: PF00069 Protein kinase domain Length = 483 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 404 AFSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 AF + + EAI YT + L SA + +R Q Y Sbjct: 385 AFRRKDFSEAIEFYTQFLDLGMISATVLVRRSQSY 419 >At1g04190.1 68414.m00409 tetratricopeptide repeat (TPR)-containing protein low similarity to protein antigen LmSTI1 [Leishmania major] GI:1698880; contains Pfam profile PF00515 TPR Domain; EST gb|Z47802 and gb|Z48402 come from this gene Length = 328 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +2 Query: 407 FSEQKYDEAINLYTAAIQLNPQSALLFAKRGQVY 508 F + +A LYT AI+L+P +A L++ R + Sbjct: 26 FKAGNFLKAAALYTQAIKLDPSNATLYSNRAAAF 59 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,840,409 Number of Sequences: 28952 Number of extensions: 326236 Number of successful extensions: 734 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -