BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30388.Seq (429 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0140 + 12255418-12255512,12257514-12257793 112 1e-25 08_02_1181 - 24985963-24986242,24987109-24987197 109 9e-25 02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649 91 3e-19 03_03_0179 - 15148688-15149251 29 2.1 01_03_0147 - 13125065-13126679,13126802-13127664 28 3.7 01_06_0668 + 31058497-31059510,31059609-31059676,31060189-310602... 27 6.4 03_02_0178 + 6195402-6199158,6199438-6200003 27 8.5 >06_02_0140 + 12255418-12255512,12257514-12257793 Length = 124 Score = 112 bits (270), Expect = 1e-25 Identities = 50/74 (67%), Positives = 61/74 (82%) Frame = +1 Query: 31 KGERKGKSAINEVVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTR 210 K +R G + +EVVTREYT+NLHKRLHG FKK+AP AIKEIRKFA+K MGT D+RVD + Sbjct: 4 KKQRPGGARKDEVVTREYTINLHKRLHGCTFKKKAPNAIKEIRKFAQKAMGTIDVRVDVK 63 Query: 211 LNKFLWSKGVRNVP 252 LNK +WS G+R+VP Sbjct: 64 LNKHIWSSGIRSVP 77 Score = 30.3 bits (65), Expect = 0.69 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +3 Query: 285 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 377 ND+ED+ +L++LVT VP +KGL T+ V+ Sbjct: 89 NDEEDAKEELYSLVTVAEVPQEGLKGLGTKLVE 121 >08_02_1181 - 24985963-24986242,24987109-24987197 Length = 122 Score = 109 bits (262), Expect = 9e-25 Identities = 50/73 (68%), Positives = 60/73 (82%), Gaps = 1/73 (1%) Frame = +1 Query: 37 ERKGKSAINE-VVTREYTVNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPDIRVDTRL 213 E+KG +A E VVTREYT+NLHKRLH FKK+AP AIKEIRKFA+K MGT D+RVD +L Sbjct: 3 EKKGGAARKEEVVTREYTINLHKRLHSCTFKKKAPNAIKEIRKFAQKAMGTTDVRVDVKL 62 Query: 214 NKFLWSKGVRNVP 252 NK +WS G+R+VP Sbjct: 63 NKHIWSSGIRSVP 75 Score = 31.9 bits (69), Expect = 0.23 Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +3 Query: 285 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 377 ND+ED+ +L++LVT VP +KGL T+ VD Sbjct: 87 NDEEDAKEELYSLVTVAEVPPEGLKGLGTKVVD 119 >02_05_0532 - 29814199-29814478,29814922-29814969,29815558-29815649 Length = 139 Score = 91.5 bits (217), Expect = 3e-19 Identities = 46/80 (57%), Positives = 56/80 (70%), Gaps = 16/80 (20%) Frame = +1 Query: 61 NEVVTREYTVNLHKRLHGV----------------GFKKRAPRAIKEIRKFAEKQMGTPD 192 +EVVTREYT+NLHKRLHG FKK+AP AIKEIRKFA+K MGT D Sbjct: 13 DEVVTREYTINLHKRLHGCIVCSNDLIHYAPDIVSTFKKKAPNAIKEIRKFAQKAMGTTD 72 Query: 193 IRVDTRLNKFLWSKGVRNVP 252 IR+D +LNK +W+ G+R+VP Sbjct: 73 IRIDVKLNKAIWTNGIRSVP 92 Score = 30.7 bits (66), Expect = 0.52 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 2/33 (6%) Frame = +3 Query: 285 NDDEDSAHKLFTLVTY--VPVASIKGLQTENVD 377 ND+ED+ +L++LVT +P +KGL T+ V+ Sbjct: 104 NDEEDAKEELYSLVTVAEIPAEGLKGLGTKVVE 136 >03_03_0179 - 15148688-15149251 Length = 187 Score = 28.7 bits (61), Expect = 2.1 Identities = 21/64 (32%), Positives = 30/64 (46%), Gaps = 4/64 (6%) Frame = -1 Query: 306 VRNLHHHYVFVKASHGHEGNIS----DSLRPKEFV*ASVYSNVRSSHLFFSELSDFFDCS 139 +R+LH V+ S GHE +I RP F S+ ++V + H F + D S Sbjct: 48 IRSLHRPTVYGHYSTGHEDSIEAYFHSCRRPVPFFLPSLPASVSTGHDFLRSYREILD-S 106 Query: 138 WGTL 127 GTL Sbjct: 107 CGTL 110 >01_03_0147 - 13125065-13126679,13126802-13127664 Length = 825 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -2 Query: 260 DTKGTFLTPLDQRNLFKRVSTRMSGVPICFS 168 +T ++LT L RNL + + R +G P C++ Sbjct: 477 ETARSYLTDLISRNLIQALHLRHNGTPSCYT 507 >01_06_0668 + 31058497-31059510,31059609-31059676,31060189-31060270, 31060339-31060431,31060516-31060668,31060900-31060968, 31061091-31061184,31061594-31061677,31062133-31062221, 31062340-31062456,31062567-31062707,31062823-31063005 Length = 728 Score = 27.1 bits (57), Expect = 6.4 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +1 Query: 88 VNLHKRLHGVGFKKRAPRAIKEIRKFAEKQMGTPD 192 +N+ ++G GF A + E+ K A KQ+ PD Sbjct: 441 LNVDSAVYGAGFYASATPQLDELLKEASKQVQNPD 475 >03_02_0178 + 6195402-6199158,6199438-6200003 Length = 1440 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +1 Query: 1 TKLKITMAKPKGERKGKSAINEVVTREYTVNL 96 T L + M KP E KGK +V+++E + + Sbjct: 704 TALNLIMGKPSAEDKGKGIAFDVLSKEEDIGV 735 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,751,027 Number of Sequences: 37544 Number of extensions: 167974 Number of successful extensions: 375 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 371 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -