BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30387.Seq (783 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04870.1 68417.m00709 CDP-alcohol phosphatidyltransferase fam... 48 7e-06 At3g55030.1 68416.m06111 phosphatidylglycerolphosphate synthase,... 48 9e-06 At2g39290.1 68415.m04824 phosphatidylglycerolphosphate synthase ... 46 3e-05 At1g68000.1 68414.m07768 CDP-diacylglycerol--inositol 3-phosphat... 36 0.030 At4g38570.1 68417.m05460 CDP-diacylglycerol--inositol 3-phosphat... 34 0.092 At3g53480.1 68416.m05904 ABC transporter family protein PDR5-lik... 30 2.0 At1g06100.1 68414.m00639 fatty acid desaturase family protein si... 30 2.0 At1g78980.1 68414.m09209 leucine-rich repeat transmembrane prote... 28 8.0 >At4g04870.1 68417.m00709 CDP-alcohol phosphatidyltransferase family protein similar to SP|Q07560 Cardiolipin synthetase (EC 2.7.8.-) {Saccharomyces cerevisiae; contains Pfam profile PF01066: CDP-alcohol phosphatidyltransferase Length = 341 Score = 48.0 bits (109), Expect = 7e-06 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 2/82 (2%) Frame = -1 Query: 504 QDLIPISLTLLIVGRDIALVVAGFVIRYISLPPP-RTLSRYFDVTHATAQ-LAPTFISKV 331 +DL+ L +++ RD+ALV +R ++L +T S +F++ ++ Q + P FISKV Sbjct: 221 KDLLHPGLVGIVLLRDVALVGGAVYLRALNLDWKWKTWSDFFNLDGSSPQKVEPLFISKV 280 Query: 330 NTAVQLLLVGTTLASPVFGYVD 265 NT QL LV + P FG D Sbjct: 281 NTVFQLTLVAGAILQPEFGNPD 302 Score = 45.6 bits (103), Expect = 4e-05 Identities = 20/46 (43%), Positives = 33/46 (71%) Frame = -2 Query: 644 LVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFISLI 507 L +G +D LDG++AR K S +GS+LDP+ADKVL+ + ++++ Sbjct: 175 LAVSGASDWLDGYVARRMKINSV-VGSYLDPLADKVLIGCVAVAMV 219 >At3g55030.1 68416.m06111 phosphatidylglycerolphosphate synthase, putative similar to phosphatidylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana]; contains non-consensus CG acceptor splice site at exon 4 Length = 233 Score = 47.6 bits (108), Expect = 9e-06 Identities = 23/48 (47%), Positives = 33/48 (68%) Frame = -2 Query: 653 TGLLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFISL 510 T + + A ITD LDG+IAR + ++ G+FLDP+ADK++VA I L Sbjct: 74 TSIFIAAAITDWLDGYIARKMR-LGSEFGAFLDPVADKLMVAATLILL 120 >At2g39290.1 68415.m04824 phosphatidylglycerolphosphate synthase (PGS1) identical to phosphatidylglycerolphosphate synthase GI:13365519 from [Arabidopsis thaliana] Length = 296 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/48 (47%), Positives = 32/48 (66%) Frame = -2 Query: 653 TGLLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFISL 510 T + + A ITD LDG++AR + S G+FLDP+ADK++VA I L Sbjct: 138 TSIFIAAAITDWLDGYLARKMRLGSA-FGAFLDPVADKLMVAATLILL 184 >At1g68000.1 68414.m07768 CDP-diacylglycerol--inositol 3-phosphatidyltransferase / phosphatidylinositol synthase (PIS1) identical to phosphatidylinositol synthase (PIS1) GB:AJ000539 [gi:3367632] Length = 227 Score = 35.9 bits (79), Expect = 0.030 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = -2 Query: 647 LLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFI--SLIGRTSYLF 486 L F+ D +DGW+AR + ST G+ LD + D+V A L + S I R S +F Sbjct: 47 LYFFSFCCDAVDGWVARRFNQVST-FGAVLDMVTDRVSTACLLVILSQIYRPSLVF 101 >At4g38570.1 68417.m05460 CDP-diacylglycerol--inositol 3-phosphatidyltransferase, putative / phosphatidylinositol synthase, putative similar to phosphatidylinositol synthase (PIS1) - Arabidopsis thaliana, PID:e1313354 [gi:3367632] Length = 225 Score = 34.3 bits (75), Expect = 0.092 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = -2 Query: 647 LLVFAGITDLLDGWIARNWKGQSTKMGSFLDPMADKVLVATLFI--SLIGRTSYLF 486 L F+ D +DGW AR + ST G+ LD + D+V A L + S I R S +F Sbjct: 44 LYFFSFCCDAVDGWCARKFNQVST-FGAVLDMVTDRVSTACLLVILSQIYRPSLVF 98 >At3g53480.1 68416.m05904 ABC transporter family protein PDR5-like ABC transporter, Spirodela polyrrhiza, EMBL:Z70524 Length = 1450 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +2 Query: 23 LIIYLHYFV*LIK*TVLLMVNKILKTIKNNLEMGIEIFHNTSRYSYFF 166 L++ +YFV + K L+M I T+ MGI+I H S S F Sbjct: 536 LLMKRNYFVYIFKTAQLVMAAFITMTVFIRTRMGIDIIHGNSYMSALF 583 >At1g06100.1 68414.m00639 fatty acid desaturase family protein similar to delta 9 acyl-lipid desaturase (ADS1) GI:2970034 from [Arabidopsis thaliana] Length = 299 Score = 29.9 bits (64), Expect = 2.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +1 Query: 346 SRCKLCGCVCYIEIPTQRSRWW*AYISNDKSSHN 447 S C +CG + T R+ WW A ++ +S HN Sbjct: 214 SACHICGSQAWQTNDTSRNVWWLALLTMGESWHN 247 >At1g78980.1 68414.m09209 leucine-rich repeat transmembrane protein kinase, putative similar to leucine-rich repeat transmembrane protein kinase 2 GI:3360291 from [Zea mays] Length = 693 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -1 Query: 414 LPPPRTLSRYFDVTHATAQLAPTFISKVNTAVQLLL 307 L PP++LSR+ D+ Q+ P F ++ V+ L+ Sbjct: 632 LYPPKSLSRFADIIALCVQVEPEFRPPMSEVVEALV 667 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,324,823 Number of Sequences: 28952 Number of extensions: 327533 Number of successful extensions: 619 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -