BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30386.Seq (439 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit S... 30 0.14 SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe... 29 0.41 SPBC16H5.12c |||conserved fungal protein|Schizosaccharomyces pom... 27 0.96 SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ... 27 1.3 SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 27 1.3 SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual 27 1.3 SPCC126.03 |pus1|SPCC126.03, SPCC126.03|tRNA pseudouridylate syn... 27 1.3 SPAC23C11.17 |||mitochondrial inner membrane protein involved in... 26 2.9 SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces po... 26 2.9 SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces pom... 25 3.9 SPAC2H10.02c |||26S proteasome regulator |Schizosaccharomyces po... 25 5.1 SPCC16C4.06c |||tRNA pseudouridylate synthase |Schizosaccharomyc... 25 5.1 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 25 6.7 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 25 6.7 SPAC144.16 |||DUF59 family protein|Schizosaccharomyces pombe|chr... 24 8.9 SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch... 24 8.9 >SPBC8D2.07c |sfc9||transcription factor TFIIIC complex subunit Sfc9 |Schizosaccharomyces pombe|chr 2|||Manual Length = 673 Score = 30.3 bits (65), Expect = 0.14 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -3 Query: 296 CSSLSRNILRRASDSGLFYGHSVTAFDSVFLLLRTESSS 180 CS L+ N+L S SG+ +GH+ D++++ + T S + Sbjct: 293 CSFLNHNLLSLCSPSGVLFGHN--DIDTIYVYILTHSGT 329 >SPAC821.08c |slp1||sleepy homolog Slp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 488 Score = 28.7 bits (61), Expect = 0.41 Identities = 14/51 (27%), Positives = 24/51 (47%) Frame = -3 Query: 314 HISKIDCSSLSRNILRRASDSGLFYGHSVTAFDSVFLLLRTESSSGSDIRW 162 H +++ C S +R++L S SG + H V + L+ SS + W Sbjct: 262 HQARVGCLSWNRHVLSSGSRSGAIHHHDVRIANHQIGTLQGHSSEVCGLAW 312 >SPBC16H5.12c |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 682 Score = 27.5 bits (58), Expect = 0.96 Identities = 22/75 (29%), Positives = 31/75 (41%) Frame = +3 Query: 117 PCRREGGLCTVAEDCPSDIRARTGLCPKQQKDGIECCYGVSVKETRVGSTAENVSRKATA 296 P REG L +A C +D+ GL YG S E V + E+ +K +A Sbjct: 208 PIGREGVLSQLATACQADLTLSAGL---------HFRYGASYNEFCVNHSPEHYLQKLSA 258 Query: 297 VNL*YMKKLQTVPKE 341 +M+ TV E Sbjct: 259 ARAQFMEVYDTVKAE 273 >SPBP23A10.14c |ell1||RNA polymerase II transcription elongation factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual Length = 533 Score = 27.1 bits (57), Expect = 1.3 Identities = 20/71 (28%), Positives = 34/71 (47%) Frame = -1 Query: 289 AFRETFSAVLPTLVSFTDTP*QHSIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSS 110 +F +T S +P++ S + QH IP SP+L+ S ++S + R GS Sbjct: 321 SFIDTNSPSMPSISSVSSYQQQHRIPKLNASNYSPLLSPSSHRKTSGNLS-----RTGSE 375 Query: 109 CSMESISQKSS 77 S S+S ++ Sbjct: 376 SSAVSLSDTTN 386 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 27.1 bits (57), Expect = 1.3 Identities = 14/28 (50%), Positives = 17/28 (60%) Frame = -2 Query: 282 EKHSPPCFRLWSLLRTLRNSIRFRLFAA 199 E P C ++LL T R+S RFRLF A Sbjct: 335 ETTPPSCEVSYNLLLTCRSSNRFRLFPA 362 >SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1236 Score = 27.1 bits (57), Expect = 1.3 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -3 Query: 254 SGLFYGHSVTAFDSVFLLLRTESSSGSDIRWTVLSHSTQTTFPAA 120 SG+ + F SV +L + +SS S ++ S ST +TF +A Sbjct: 562 SGISSSSIPSTFSSVSSILSSSTSSPSSTSLSISSSSTSSTFSSA 606 >SPCC126.03 |pus1|SPCC126.03, SPCC126.03|tRNA pseudouridylate synthase Lsp1|Schizosaccharomyces pombe|chr 3|||Manual Length = 534 Score = 27.1 bits (57), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -2 Query: 279 KHSPPCFRLWSLLRTLRNSIRFRLF 205 +H PP RLW ++RT+ NS R + Sbjct: 130 EHLPPSIRLWDVIRTI-NSFNPRTY 153 >SPAC23C11.17 |||mitochondrial inner membrane protein involved in potassium ion transport|Schizosaccharomyces pombe|chr 1|||Manual Length = 485 Score = 25.8 bits (54), Expect = 2.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -2 Query: 147 QYTNHLPCGTDPLVQWNLFHR 85 +Y N GTDPL+++N+ HR Sbjct: 295 RYMNLNAFGTDPLLRYNIRHR 315 >SPBC14F5.11c |mug186||sorting nexin Snx41|Schizosaccharomyces pombe|chr 2|||Manual Length = 586 Score = 25.8 bits (54), Expect = 2.9 Identities = 15/46 (32%), Positives = 19/46 (41%) Frame = -1 Query: 214 PSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSSCSMESISQKSS 77 PS +G L DG T LRH S E++SQ +S Sbjct: 426 PSVPLMGTDQPLENYHDGNGEQTEECLRDLRHNQSQDFETVSQDTS 471 >SPBC19F8.03c |||clathrin binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 25.4 bits (53), Expect = 3.9 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = -1 Query: 190 SPVLALISDGQSSATVHKPPSLRHGSSCSMESISQK 83 SP + +G H P HG S S +I QK Sbjct: 569 SPAHIMYPEGSPGFIQHSPNGFTHGHSASPVNIGQK 604 >SPAC2H10.02c |||26S proteasome regulator |Schizosaccharomyces pombe|chr 1|||Manual Length = 213 Score = 25.0 bits (52), Expect = 5.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 84 FCEIDSIEQEDPCRREGGLC 143 FC +DS+ E P +E GLC Sbjct: 129 FCVVDSVAVESPA-QEAGLC 147 >SPCC16C4.06c |||tRNA pseudouridylate synthase |Schizosaccharomyces pombe|chr 3|||Manual Length = 413 Score = 25.0 bits (52), Expect = 5.1 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 270 PPCFRLWSLLRTLRN 226 PPC R+W + RT + Sbjct: 128 PPCIRVWKMARTFNS 142 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 24.6 bits (51), Expect = 6.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 117 PCRREGGLCTVAEDCPSDIRARTGLCPKQQ 206 P +R+G + + + C SD R R + PK Q Sbjct: 418 PLKRDGHV--IIDVCDSDARLRRNIVPKSQ 445 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 24.6 bits (51), Expect = 6.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 117 PCRREGGLCTVAEDCPSDIRARTGLCPKQQ 206 P +R+G + + + C SD R R + PK Q Sbjct: 418 PLKRDGHV--IIDVCDSDARLRRNIVPKSQ 445 >SPAC144.16 |||DUF59 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 179 Score = 24.2 bits (50), Expect = 8.9 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = -1 Query: 166 DGQSSATVHKPPSLRHGSSCSM 101 +G S TVH P++ H S C++ Sbjct: 93 EGDSYITVHITPTIPHCSMCTL 114 >SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1316 Score = 24.2 bits (50), Expect = 8.9 Identities = 11/53 (20%), Positives = 24/53 (45%) Frame = -1 Query: 223 HSIPSFCCLGQSPVLALISDGQSSATVHKPPSLRHGSSCSMESISQKSSSLFP 65 H I F P+ A D +S +VH+ + ++ ++S++++ P Sbjct: 437 HDISQFNHRNDPPITAASVDSSNSFSVHRSSTNHSSTNSGSPNLSRRNNLAIP 489 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,672,757 Number of Sequences: 5004 Number of extensions: 33969 Number of successful extensions: 119 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 158122380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -