BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30383.Seq (891 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 3e-19 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 82 7e-16 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 82 7e-16 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 82 7e-16 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 76 3e-14 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 73 4e-13 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 72 7e-13 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 70 2e-12 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 70 2e-12 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 69 5e-12 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 69 7e-12 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 69 7e-12 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 69 7e-12 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 69 7e-12 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 69 7e-12 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 69 7e-12 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 69 7e-12 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 69 7e-12 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 69 7e-12 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 69 7e-12 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 69 7e-12 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 69 7e-12 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 69 7e-12 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 69 7e-12 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 69 7e-12 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 69 7e-12 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 69 7e-12 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 69 7e-12 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 69 7e-12 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 69 7e-12 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 69 7e-12 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 69 7e-12 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 69 7e-12 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 69 7e-12 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 69 7e-12 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 69 7e-12 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 69 7e-12 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 69 7e-12 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 69 7e-12 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 69 7e-12 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 69 7e-12 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 69 7e-12 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 69 7e-12 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 69 7e-12 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 69 7e-12 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 69 7e-12 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 69 7e-12 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 7e-12 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 68 9e-12 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 68 9e-12 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 68 9e-12 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 68 9e-12 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 68 9e-12 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 68 9e-12 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 68 9e-12 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 68 9e-12 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 68 9e-12 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 68 9e-12 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 68 9e-12 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 68 9e-12 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 68 9e-12 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 68 9e-12 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 68 9e-12 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 68 9e-12 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 68 9e-12 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 68 9e-12 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 68 9e-12 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 68 9e-12 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 68 9e-12 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 68 9e-12 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 68 9e-12 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 68 9e-12 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 68 9e-12 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 68 9e-12 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 68 9e-12 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 68 9e-12 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 68 9e-12 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 68 9e-12 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 68 9e-12 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 68 9e-12 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 68 9e-12 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 68 9e-12 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 68 9e-12 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 68 9e-12 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 68 9e-12 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 68 9e-12 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 68 9e-12 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 68 9e-12 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 68 9e-12 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 68 9e-12 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 68 9e-12 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 68 9e-12 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 68 9e-12 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 68 9e-12 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 68 9e-12 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 68 9e-12 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 68 9e-12 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 68 9e-12 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 68 9e-12 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 68 9e-12 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 68 9e-12 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 68 9e-12 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 9e-12 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 68 9e-12 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 68 1e-11 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 1e-11 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 68 1e-11 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 67 2e-11 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 67 2e-11 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 67 2e-11 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 67 2e-11 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 67 2e-11 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 67 2e-11 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 67 2e-11 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 67 2e-11 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 67 2e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 67 2e-11 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 67 2e-11 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 67 2e-11 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 67 2e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 67 2e-11 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 2e-11 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 66 3e-11 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_55134| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 66 4e-11 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 4e-11 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 66 5e-11 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 66 5e-11 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 66 5e-11 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 66 5e-11 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 66 5e-11 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 66 5e-11 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 66 5e-11 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 66 5e-11 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 66 5e-11 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 66 5e-11 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 66 5e-11 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 66 5e-11 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 66 5e-11 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 66 5e-11 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 66 5e-11 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 66 5e-11 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 66 5e-11 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 66 5e-11 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 66 5e-11 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 66 5e-11 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 66 5e-11 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 93.1 bits (221), Expect = 3e-19 Identities = 42/57 (73%), Positives = 43/57 (75%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPVNCNTTHYRANW 458 NCWEG SVRA + KGGCAARRLSWVTPGF VKRRPVNCNTTHYRANW Sbjct: 25 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 81.8 bits (193), Expect = 7e-16 Identities = 40/60 (66%), Positives = 41/60 (68%) Frame = -3 Query: 637 RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPVNCNTTHYRANW 458 R NCWEG SVRA + KGGCAARRLSW GF VKRRPVNCNTTHYRANW Sbjct: 593 RLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 81.8 bits (193), Expect = 7e-16 Identities = 40/60 (66%), Positives = 41/60 (68%) Frame = -3 Query: 637 RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPVNCNTTHYRANW 458 R NCWEG SVRA + KGGCAARRLSW GF VKRRPVNCNTTHYRANW Sbjct: 36 RLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 81.8 bits (193), Expect = 7e-16 Identities = 40/60 (66%), Positives = 41/60 (68%) Frame = -3 Query: 637 RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPVNCNTTHYRANW 458 R NCWEG SVRA + KGGCAARRLSW GF VKRRPVNCNTTHYRANW Sbjct: 36 RLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSW---GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 81.0 bits (191), Expect = 1e-15 Identities = 40/55 (72%), Positives = 43/55 (78%), Gaps = 2/55 (3%) Frame = +3 Query: 492 TGRRFTRRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 TGRRFTRRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 93 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 76.2 bits (179), Expect = 3e-14 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 492 TGRRFTRRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 TGRR RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 15 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 68 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 76.2 bits (179), Expect = 3e-14 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 492 TGRRFTRRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 TGRR RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 35 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 88 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 76.2 bits (179), Expect = 3e-14 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 492 TGRRFTRRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 TGRR RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 25 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 78 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 76.2 bits (179), Expect = 3e-14 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 492 TGRRFTRRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 TGRR RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 45 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 98 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 76.2 bits (179), Expect = 3e-14 Identities = 38/55 (69%), Positives = 41/55 (74%), Gaps = 2/55 (3%) Frame = +3 Query: 492 TGRRFTRRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 TGRR RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 72 TGRRLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 125 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 74.1 bits (174), Expect = 1e-13 Identities = 35/46 (76%), Positives = 36/46 (78%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVKRRPV 491 NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR KRRPV Sbjct: 4 NCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 72.5 bits (170), Expect = 4e-13 Identities = 38/54 (70%), Positives = 43/54 (79%), Gaps = 2/54 (3%) Frame = -2 Query: 647 SPFXVR--QLLGRAIGAGPLRLLRQLAKRGMCCKAIKLGNARVFPVTTCKTTAS 492 +PF ++ QLLGRAIGAG L + +RGMCCKAIKLGNARVFPVTT KTTAS Sbjct: 10 APFAIQAAQLLGRAIGAG-LFAITPAGERGMCCKAIKLGNARVFPVTTFKTTAS 62 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 71.7 bits (168), Expect = 7e-13 Identities = 33/54 (61%), Positives = 38/54 (70%) Frame = -3 Query: 664 RLQXPIRHSRCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 +L+ P+ + NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 242 QLKKPVNREKLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 294 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = -2 Query: 620 GRAIGAGPLRLLRQLAKRGMCCKAIKLGNARVFPVTTCKTTASEL 486 GR++ A L LRQLAK G + + CKTTASEL Sbjct: 258 GRSVRASSL--LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 70.5 bits (165), Expect = 2e-12 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRMGXCKR 665 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ C + Sbjct: 176 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRLMRCDK 228 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 224 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 70.5 bits (165), Expect = 2e-12 Identities = 34/48 (70%), Positives = 35/48 (72%) Frame = -3 Query: 646 RHSRCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 R SR NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 107 RESRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 153 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 70.1 bits (164), Expect = 2e-12 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 2/52 (3%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRMGXC 659 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ C Sbjct: 59 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRLMRC 109 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 107 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 70.1 bits (164), Expect = 2e-12 Identities = 36/54 (66%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRMGXCKR 665 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ KR Sbjct: 57 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRLMRTKR 109 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 105 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 69.3 bits (162), Expect = 4e-12 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -3 Query: 628 NCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 NCWEG SVRA ++ + KGGCAARRLSWVTPGFSQSRR K Sbjct: 4 NCWEGRSVRA-YSLFRQLAKGGCAARRLSWVTPGFSQSRRCK 44 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 68.9 bits (161), Expect = 5e-12 Identities = 33/48 (68%), Positives = 34/48 (70%) Frame = -3 Query: 646 RHSRCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 R R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 1102 RRGRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 1148 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 471 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 519 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 64 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 112 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 645 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 693 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 554 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 602 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 10 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 58 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 187 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 235 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) Length = 206 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1411 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) Length = 1106 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 913 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 961 >SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) Length = 195 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) Length = 140 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) Length = 270 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) Length = 800 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 261 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 309 >SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) Length = 110 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) Length = 157 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) Length = 271 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) Length = 766 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) Length = 188 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 Score = 36.3 bits (80), Expect = 0.033 Identities = 18/30 (60%), Positives = 19/30 (63%) Frame = -1 Query: 636 GAXTVGKGXRCGPSSPITPAGEKGDVLQGD 547 G TVGKG RCGP + KGDVLQGD Sbjct: 90 GCATVGKGDRCGPLR-YYASWRKGDVLQGD 118 >SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 67 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 115 >SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 68.5 bits (160), Expect = 7e-12 Identities = 35/50 (70%), Positives = 36/50 (72%), Gaps = 2/50 (4%) Frame = -3 Query: 646 RHS--RCXNCWEGXSVRALFAYYASWRKGGCAARRLSWVTPGFSQSRRVK 503 RHS R NCWEG SVRA + KGGCAARRLSWVTPGFSQSRR K Sbjct: 18 RHSPFRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCK 66 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 116 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 31 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 78 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 79 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 103 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 34 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 81 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 82 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 35 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 82 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 24 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 71 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 839 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 886 Score = 30.3 bits (65), Expect = 2.2 Identities = 24/76 (31%), Positives = 30/76 (39%) Frame = +1 Query: 433 KNSRGGPVXXXXXXXXXXXXLAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPX 612 K SRG P+ LAVVL + + L L P FASWRN Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 872 Query: 613 ALPNSXRTXNGEWAIV 660 R+ NGEW ++ Sbjct: 873 P-SQQLRSLNGEWRLM 887 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 120 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 167 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 168 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 93 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 74 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 17 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 64 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 65 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 25 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 72 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 73 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 141 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 142 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 43 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 90 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 91 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 138 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 185 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 186 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 76 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 159 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 206 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 207 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 111 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 27 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 74 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 75 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 53 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 100 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 66 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 113 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 114 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 219 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 266 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 267 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 39 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 86 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 87 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 54 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 101 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 102 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 93 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 94 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 81 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 128 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 129 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 76 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 111 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 106 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 153 Score = 30.7 bits (66), Expect = 1.7 Identities = 24/80 (30%), Positives = 30/80 (37%) Frame = +1 Query: 421 QXKKKNSRGGPVXXXXXXXXXXXXLAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRG 600 Q K N+R G LAVVL + + L L P FASWRN Sbjct: 77 QTSKSNARAGD-PLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 135 Query: 601 PAPXALPNSXRTXNGEWAIV 660 R+ NGEW ++ Sbjct: 136 RTDRP-SQQLRSLNGEWRLM 154 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 127 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 34 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 81 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 82 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 152 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 199 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 200 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 112 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 113 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 141 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 142 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 106 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 153 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 154 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 1196 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 1243 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/33 (63%), Positives = 22/33 (66%) Frame = -3 Query: 637 RCXNCWEGXSVRALFAYYASWRKGGCAARRLSW 539 R NCWEG SVRA + KGGCAARRLSW Sbjct: 408 RLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSW 439 Score = 31.5 bits (68), Expect = 0.95 Identities = 26/99 (26%), Positives = 38/99 (38%) Frame = +1 Query: 364 RSKGQEMNISCKQINA*KLQXKKKNSRGGPVXXXXXXXXXXXXLAVVLHVVTGKTLALPN 543 RS + + +I+ K + K+ S+G LAVVL + + Sbjct: 1147 RSVNEGTRHTSSKISPTKYKAGKRRSQGKGDPLESTCRHASLALAVVLQRRDWENPGVTQ 1206 Query: 544 LIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 L L P FASWRN R+ NGEW ++ Sbjct: 1207 LNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 1244 Score = 28.7 bits (61), Expect = 6.7 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 653 AHSPFXVRQLL-GRAIGAGPLRLLRQLAKRGMCCKAIKLG 537 +HSPF +R GR++ A L LRQLAK G + + G Sbjct: 403 SHSPFRLRNCWEGRSVRASSL--LRQLAKGGCAARRLSWG 440 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 38 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 85 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 86 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 131 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 178 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 179 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 83 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 130 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 37 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 84 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 85 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 89 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 90 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 102 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 149 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 150 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 67 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 114 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 115 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 137 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 138 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 93 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 94 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 137 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 138 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 90 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 137 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 138 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 27 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 74 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 75 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 71 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 118 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 119 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 30 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 77 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 78 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 114 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 161 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 162 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 30 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 77 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 78 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 96 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 97 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 82 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 129 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 130 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 73 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 120 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 121 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 97 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 144 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 145 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 47 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 94 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 95 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 1069 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 1116 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 1117 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 37 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 84 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 85 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 140 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 187 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 188 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 188 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 235 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 236 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 65 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 112 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 113 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 25 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 72 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 73 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 152 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 199 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 200 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 112 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 122 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 169 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 170 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 29 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 76 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 77 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 658 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 705 Score = 33.1 bits (72), Expect = 0.31 Identities = 22/66 (33%), Positives = 28/66 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIVSVXX 672 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLMRYFL 710 Query: 673 LXKISR 690 L +SR Sbjct: 711 LTHLSR 716 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 45 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 92 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 93 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 167 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 214 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 215 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 53 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 100 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 101 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 38 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 85 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 86 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 76 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 112 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 76 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 124 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 71 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 66 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 113 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 549 RLAAHPPFRQLA**AKRARTDXPSQQLXHL 638 +++AHPPF ++ ARTD PSQQL L Sbjct: 14 QVSAHPPFASWRN-SEEARTDRPSQQLRSL 42 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 114 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 77 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 124 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 125 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 85 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 132 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 133 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 191 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 238 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 239 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 450 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 497 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 498 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 127 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 272 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 319 Score = 30.7 bits (66), Expect = 1.7 Identities = 22/70 (31%), Positives = 28/70 (40%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIVSVXX 672 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLMRYFL 324 Query: 673 LXKISRXIFG 702 L + I G Sbjct: 325 LTHLCDEIEG 334 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 74 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 88 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 67 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 114 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 115 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 76 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 123 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 124 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 110 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 157 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 158 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 69 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 116 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 117 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 127 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 127 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 71 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 80 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 127 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 128 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 89 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 136 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 137 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 182 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 229 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 230 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 37 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 84 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 85 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 89 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 136 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 137 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 74 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 103 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 79 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 126 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 127 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 148 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 195 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 196 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 74 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 121 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 122 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 111 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 75 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 122 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 123 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 74 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 22 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 69 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 70 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 92 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 50 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 97 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 98 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 116 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 87 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 134 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 135 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 197 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 244 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 245 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 93 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 140 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 141 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 110 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 157 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 158 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 44 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 91 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 92 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 56 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 103 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 104 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 55 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 102 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 103 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 47 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 94 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 95 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 28 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 75 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 76 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 74 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 132 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 179 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 180 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 49 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 96 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 97 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 75 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 122 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 123 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 61 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 108 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 109 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 24 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 71 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 72 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 60 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 107 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 108 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 94 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 141 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 142 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 61 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 108 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 109 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 64 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 111 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 112 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 26 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 73 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 74 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 100 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 147 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 148 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 71 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 118 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 119 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 173 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 220 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 221 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 68 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 115 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 116 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 48 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 95 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 96 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 23 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 70 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 71 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 39 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 86 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 87 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 85 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 132 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 133 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 63 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 110 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 111 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 88 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 111 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 158 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 159 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 52 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 99 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 100 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 42 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 89 Score = 29.9 bits (64), Expect = 2.9 Identities = 23/78 (29%), Positives = 30/78 (38%) Frame = +1 Query: 427 KKKNSRGGPVXXXXXXXXXXXXLAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPA 606 +K RG P+ LAVVL + + L L P FASWRN Sbjct: 16 RKSRHRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART 73 Query: 607 PXALPNSXRTXNGEWAIV 660 R+ NGEW ++ Sbjct: 74 DRP-SQQLRSLNGEWRLM 90 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 125 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 172 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 173 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 158 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 205 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 206 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 108 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 155 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 156 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 68.1 bits (159), Expect = 9e-12 Identities = 34/49 (69%), Positives = 37/49 (75%), Gaps = 2/49 (4%) Frame = +3 Query: 510 RRDWENPGVTQLNRLAAHPPFRQLA**AKRARTDXPSQQLXHL--EWRM 650 RRDWENPGVTQLNRLAAHPPF ++ ARTD PSQQL L EWR+ Sbjct: 40 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQQLRSLNGEWRL 87 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = +1 Query: 493 LAVVLHVVTGKTLALPNLIALQHIPLFASWRNRRRGPAPXALPNSXRTXNGEWAIV 660 LAVVL + + L L P FASWRN R+ NGEW ++ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP-SQQLRSLNGEWRLM 88 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,336,523 Number of Sequences: 59808 Number of extensions: 416000 Number of successful extensions: 10279 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4751 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7364 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -