BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30379.Seq (763 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81462-1|CAB03840.1| 125|Caenorhabditis elegans Hypothetical pr... 50 2e-06 U41274-7|AAA82463.1| 1610|Caenorhabditis elegans Hypothetical pr... 33 0.22 >Z81462-1|CAB03840.1| 125|Caenorhabditis elegans Hypothetical protein C04H5.1 protein. Length = 125 Score = 50.0 bits (114), Expect = 2e-06 Identities = 27/96 (28%), Positives = 46/96 (47%), Gaps = 1/96 (1%) Frame = +2 Query: 242 LERCLTGYPLAINATDIKVKEVDFNPEFISRVIPKLDWEVLWVAADSIGHSDGLPRSLEN 421 L+ GYPL + K+++F+ + ++ ++ +E L VAA ++ SD +PR Sbjct: 14 LKNVTVGYPLNLVVKQFVEKDIEFDRDNTIVMLDRIQYEALIVAAAAVNQSDRIPREKPE 73 Query: 422 KYDE-NEEFLKKAHKXXXXXXXXXGHLTCPNLEDNF 526 K+DE +E L+ H G L CP + F Sbjct: 74 KWDELTDEQLRVFHHLLMNIDVIDGELICPETKTVF 109 >U41274-7|AAA82463.1| 1610|Caenorhabditis elegans Hypothetical protein T04G9.1 protein. Length = 1610 Score = 33.1 bits (72), Expect = 0.22 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 257 TGYPLAINATDIKV-KEVDFNPEFISRVIPKLDWEVLWVAADSIGHSDGLPRSL 415 T Y L + +K+ +E+D NP ++ PK+D L++AADS+ + G R L Sbjct: 1159 TEYLLLLAEVKVKLFEEIDVNPRVREQLRPKIDLIDLYMAADSMNVAKGRLRRL 1212 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,987,117 Number of Sequences: 27780 Number of extensions: 326001 Number of successful extensions: 799 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 799 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1819579054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -