BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30377.Seq (651 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) 94 8e-20 SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) 30 1.9 SB_38211| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) 29 3.3 SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) 28 5.7 SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_31564| Best HMM Match : ubiquitin (HMM E-Value=0.0026) 28 7.6 >SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) Length = 176 Score = 94.3 bits (224), Expect = 8e-20 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +1 Query: 61 MNVIQAVKMYITKMXXXSGPGMKVILMDKETTSIVSMVYSQSEILQKEVYLFERIDS 231 MNVI AVK Y+TKM SG GMKV+LMDKETT IVSMVYSQ+E+LQKEVYLFER+D+ Sbjct: 1 MNVILAVKQYVTKMIEESGAGMKVLLMDKETTGIVSMVYSQTEVLQKEVYLFERVDT 57 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = +3 Query: 375 ADIKTLAECDXXXAVRXVQEVFADYLAV 458 A I+ LAE D VR VQE +ADY A+ Sbjct: 77 ASIRALAEADDQEVVREVQEYYADYFAI 104 >SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) Length = 356 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/46 (26%), Positives = 23/46 (50%) Frame = -1 Query: 192 DFRLTVHHTHYAGSFFIH*YHFHSRAAXXXHFSNVHFNCLYHIHFD 55 D+ H+ +Y + + YH+H H+ + H++ YH H+D Sbjct: 303 DYYYHYHYYYYYDYHYHYDYHYHYDYHYDYHY-DYHYHYDYHYHYD 347 >SB_38211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = +3 Query: 462 RXPVLFQYCWMPPRSGWNQQHLQRVSQGLXA 554 R PV+F+ +PPR G ++++ + + +GL A Sbjct: 56 RKPVVFEDAVLPPRFGLSREYEEEIREGLEA 86 >SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) Length = 341 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -3 Query: 334 YLGSLSSRDNRAM---FSDVGRIKTMHXMCSCYPIWHDCLSSRISKLPSVRFPID 179 YL SL R + ++ + + GR+ T+ +P + D ++ IS++P V P+D Sbjct: 207 YLRSLRKRQDMSVNTTWPNFGRVTTLVAQDMTFPSYDDVINDVISRVPFVDPPLD 261 >SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 524 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -2 Query: 164 TMLVVSLSINITFIPGPLSXXILVMYIL--TACITFILIKLSLFIS 33 T + SLS ++TF+ GPL+ + Y + A + IL L LF S Sbjct: 57 TAWIASLSFSLTFMLGPLTTSLCTKYGVRSVAVLGAILFALGLFCS 102 >SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) Length = 238 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -1 Query: 180 TVHHTHYAGSFFIH*YHFHSRAAXXXHFSNVHFNCLY--HIHFD*IILI 40 ++HH + +F H Y++H + H + H + Y H H D I+I Sbjct: 79 SIHHRYR--DYFYHSYNYHHKWQHYHHHHHYHHHLDYDHHYHHDLFIII 125 >SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/77 (18%), Positives = 34/77 (44%) Frame = +1 Query: 25 ILCEINKDNLIKMNVIQAVKMYITKMXXXSGPGMKVILMDKETTSIVSMVYSQSEILQKE 204 ++CE+ KD+ K + V + + K G ++ TT + + ++E+++ Sbjct: 15 LICELGKDDFKKTGLPMCVAIKLQKAIESLDKGKELKTSLDSTTIKANKILKKTELIELS 74 Query: 205 VYLFERIDSHAKWDNMN 255 E +++ W+ N Sbjct: 75 KKSLEAQFANSNWNEFN 91 >SB_31564| Best HMM Match : ubiquitin (HMM E-Value=0.0026) Length = 309 Score = 27.9 bits (59), Expect = 7.6 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 1/62 (1%) Frame = -2 Query: 500 WRHPTILKENRXSVHSQVVSKNFLDL-SDSXXXITFGQSFDVCXRNYITEIYKVNTIFRI 324 W P I K S+ S L SDS + Q+ +C I E++KV ++ +I Sbjct: 226 WNSPNISKYKNPSLKFYDASYPDKQLCSDSMEHAAYSQAIIMCSLCKIDEVWKVFSLRKI 285 Query: 323 SQ 318 SQ Sbjct: 286 SQ 287 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,183,560 Number of Sequences: 59808 Number of extensions: 305605 Number of successful extensions: 719 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -