BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30371.Seq (741 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.3 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 22 7.0 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = +3 Query: 234 DGATILKCWKXSILLPKS*WN*HSYKMKKLEMVPH 338 D T WK ++ + HS++MK + +V H Sbjct: 328 DTRTSTSLWKDKAMIEANVAVLHSFQMKNVTIVDH 362 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 266 EHPAAKVLVELAQLQDEEVGDGTTS 340 EHP K+L EL D + D + S Sbjct: 102 EHPNGKILRELQTDYDRRLHDNSPS 126 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,108 Number of Sequences: 438 Number of extensions: 3503 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -