BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30366.Seq (841 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1457 - 33741048-33741146,33741647-33741760,33741938-337420... 34 0.16 03_05_0977 + 29355824-29357056 31 1.5 02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242,881... 30 2.6 11_05_0063 - 18756289-18756390,18756769-18756954,18757053-187572... 29 6.1 09_06_0134 + 21065104-21065965,21066732-21066961,21067618-210678... 29 6.1 03_06_0011 - 30995083-30995108,30995850-30996038,30996063-30998856 29 6.1 >04_04_1457 - 33741048-33741146,33741647-33741760,33741938-33742052, 33742154-33742560,33743342-33743476,33743576-33743970, 33744225-33744916,33745014-33745097,33745195-33745286, 33745374-33745457,33745535-33745714,33746258-33746302, 33746399-33746692,33747199-33747585,33747713-33747899, 33748042-33748118,33748936-33749067,33749315-33749416, 33749744-33749827,33749902-33749992,33750105-33750178, 33750644-33750664,33751433-33751477,33752427-33752561, 33752693-33752752 Length = 1376 Score = 33.9 bits (74), Expect = 0.16 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +3 Query: 321 DSLGVGSYG*TNTNSWKGNPSYVPLGSISLEGIVSEELNMSVGIFPW 461 D +G G+YG N +V + +SLE I E+LN+ + F W Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIPQEDLNIIMSTFMW 70 >03_05_0977 + 29355824-29357056 Length = 410 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 213 DLLEEHVRLFEVLRRTGRSNG*PNG-LLSGTTDLNGSDSLGVGSYG*TNTN 362 D+L ++LF L N PNG L S +TD + S+ G G T TN Sbjct: 330 DVLNNQIKLFIDLTSAAELNYRPNGTLASASTDAENATSVDRGHDGNTGTN 380 >02_02_0307 - 8809724-8811589,8811681-8811762,8812130-8812242, 8812361-8812492,8812681-8812864,8813002-8813135, 8813552-8813656,8813738-8813839,8813930-8814022, 8814136-8814456,8814595-8814696,8814791-8814853, 8815213-8815708,8815964-8816124,8816213-8816743, 8817077-8817118,8817203-8817334,8817639-8817703, 8817858-8818169,8818262-8818334,8818425-8818517, 8819440-8819501,8819740-8819809 Length = 1777 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 780 SKGGTQGSPHGLQGPSXS 727 S GGT+ SPHGL PS S Sbjct: 1661 SPGGTEASPHGLPSPSDS 1678 >11_05_0063 - 18756289-18756390,18756769-18756954,18757053-18757223, 18757339-18757383,18758087-18758260,18758801-18758887, 18759349-18759510,18759945-18760015,18760296-18760435, 18760828-18760952,18761329-18761463,18762069-18762314, 18762530-18762755,18763039-18763091 Length = 640 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -1 Query: 361 FVFVYPYEPTPKESEPFKSVVPDNKPFGYPFDR 263 F +PYEPTP +++ F V D P DR Sbjct: 79 FTAEFPYEPTPDQNQAFIDVDKDLTERETPMDR 111 >09_06_0134 + 21065104-21065965,21066732-21066961,21067618-21067841, 21067929-21068781 Length = 722 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/43 (27%), Positives = 24/43 (55%) Frame = +2 Query: 344 RIDEYKQLEGESIVCTLRQHQPRRHSVRGVEHVSRNLSLVQEL 472 +I YK+ E + I L +H+P + + + +EH+S ++ L Sbjct: 598 KISAYKRAENKVIETKLLEHRPEQDAKQRMEHLSEKKEMLNVL 640 >03_06_0011 - 30995083-30995108,30995850-30996038,30996063-30998856 Length = 1002 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 360 NSWKGNPSYVPLGSISLEGIVSEELNMSVGIFPWSKSL*ISAIGKESSLKMQS 518 NS +GNPS P G +L V + +++ G P S S + + G S +++ S Sbjct: 658 NSIQGNPSLQPCGLSTLANTVMKARSLAEGDVPPSDSATVDSGGGFSKIEIAS 710 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,138,709 Number of Sequences: 37544 Number of extensions: 346853 Number of successful extensions: 684 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2326952232 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -