BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30363.Seq (715 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 164 6e-43 DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein ... 24 1.6 AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein ... 24 1.6 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 22 5.0 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 22 5.0 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 22 6.6 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.6 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 22 6.6 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 22 6.6 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.8 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 21 8.8 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 8.8 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 21 8.8 >AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 protein. Length = 208 Score = 164 bits (399), Expect = 6e-43 Identities = 98/169 (57%), Positives = 108/169 (63%), Gaps = 11/169 (6%) Frame = +1 Query: 31 MGISRDHWHKRRATGWETCAHTQEEEV*XRASRCKHQARPSAN----PLRSFTWWKY*VP 198 MGISRDHWHKRRATG + R R RP+AN P R T Sbjct: 1 MGISRDHWHKRRATGGKRKP--------IRKKRKFELGRPAANTKLGPQRIHT---VRTR 49 Query: 199 CAASGHR*LLLGIGMFN-------SQTRIIDVVYNASNNELVRTKTLVKNAIVVVDATPF 357 +R L L G F+ +TRIIDVVYNASNNELVRTKTLVKNAIV +DATPF Sbjct: 50 GGNKKYRALRLDTGNFSWGSECTTRKTRIIDVVYNASNNELVRTKTLVKNAIVTIDATPF 109 Query: 358 RQWYESHYTLPLGRKKGAKLTEAEEAIINKKRSQKTARKYLARQRLAKV 504 RQWYE HY LPLGRK+GAKLTEAEE ++NKKRS+K KY ARQR AKV Sbjct: 110 RQWYEGHYVLPLGRKRGAKLTEAEEEVLNKKRSKKAEAKYKARQRFAKV 158 Score = 119 bits (286), Expect = 3e-29 Identities = 52/60 (86%), Positives = 57/60 (95%) Frame = +2 Query: 77 GKRAPIRKKRKYXLGRPAANTRLGPQRIHSVRSRGGNTKYRALRLDTGNFSWGSECSTRK 256 GKR PIRKKRK+ LGRPAANT+LGPQRIH+VR+RGGN KYRALRLDTGNFSWGSEC+TRK Sbjct: 16 GKRKPIRKKRKFELGRPAANTKLGPQRIHTVRTRGGNKKYRALRLDTGNFSWGSECTTRK 75 Score = 60.5 bits (140), Expect = 2e-11 Identities = 28/48 (58%), Positives = 32/48 (66%) Frame = +3 Query: 510 ALEEQFHTGRLLACVASRPGQCGRADGYIXXXXXXXXXXXXXXSKRAK 653 ALEEQF TGR+LAC++SRPGQCGR DGYI SK+AK Sbjct: 161 ALEEQFATGRVLACISSRPGQCGREDGYILEGKELEFYMRRIKSKKAK 208 >DQ855485-1|ABH88172.1| 128|Apis mellifera chemosensory protein 4 protein. Length = 128 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 339 YNNCILDKGLCT 304 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >AJ973400-1|CAJ01447.1| 128|Apis mellifera hypothetical protein protein. Length = 128 Score = 23.8 bits (49), Expect = 1.6 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 339 YNNCILDKGLCT 304 Y NC+LD+G CT Sbjct: 46 YVNCLLDQGPCT 57 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 339 YNNCILDKGLCTHQ 298 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -2 Query: 339 YNNCILDKGLCTHQ 298 Y C+LD+G CT++ Sbjct: 43 YIKCMLDEGPCTNE 56 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = -2 Query: 546 PANALCGIALLEHLNLSK 493 P N+LC + L+ LNL++ Sbjct: 163 PVNSLCSLDNLQTLNLTE 180 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y++C Sbjct: 104 LQPYPDWSFAKYDDC 118 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y +C Sbjct: 109 LQPYPDWSFAKYEDC 123 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y +C Sbjct: 110 LRPYPDWSFAKYEDC 124 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 21.4 bits (43), Expect = 8.8 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -2 Query: 372 LIPLPEWSCIYYNNC 328 L P P+WS Y +C Sbjct: 108 LQPYPDWSWANYKDC 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,458 Number of Sequences: 438 Number of extensions: 3489 Number of successful extensions: 19 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -