BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30354.Seq (767 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 1.8 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 24 1.8 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 4.1 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 22 7.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 7.2 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 22 7.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 9.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 9.5 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 9.5 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.5 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 9.5 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 271 KRIASQTPFKHFEVSILWVISFIIIF 194 K ++ ++HF I W+ FI+IF Sbjct: 393 KSRTKESAWRHFAAIIEWLSFFIVIF 418 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -2 Query: 739 HXLKYLNXKPNLHAPXALLYI 677 H L Y P+LH ALLYI Sbjct: 36 HWLVYPEPNPSLHYLLALLYI 56 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 22.6 bits (46), Expect = 4.1 Identities = 21/82 (25%), Positives = 34/82 (41%), Gaps = 4/82 (4%) Frame = +2 Query: 197 YNNETNYPQYAHFEMLERCLTGYPLAINATDIKVKEVDFNPEFISRVIPKLDW---EVLW 367 Y+N +PQ F L Y INA ++++ + + I K+D E L Sbjct: 303 YSNGVTFPQRNRFSSLPYYKYKYLNVINALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLN 362 Query: 368 VAADSI-GHSDGLPRSLENKYD 430 + + I G+SD + YD Sbjct: 363 MLGNVIEGNSDSINTKFYGMYD 384 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 230 HFEMLERCLTGYPLAINATDIKVKEV 307 H E L L G + N +I VKE+ Sbjct: 295 HHEALTEALPGDNVGFNVKNISVKEL 320 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 7.2 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +2 Query: 197 YNNETNYPQYAHFEMLERCLTGYPLAINATDIKVKEVDFNPEFISRVIPKLD 352 Y+N +PQ F L Y INA ++++ + + I K+D Sbjct: 303 YSNGVTFPQRNRFSSLPYYKYKYLNVINALEMRLMDAIDSGYLIDEYGKKID 354 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 21.8 bits (44), Expect = 7.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 230 HFEMLERCLTGYPLAINATDIKVKEV 307 H E L L G + N +I VKE+ Sbjct: 6 HHEALTEALPGDNVGFNVKNISVKEL 31 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 50 SNYARKVHNNKYVLRKFYKKV 112 +NY K +NN Y +K Y + Sbjct: 307 NNYNYKNYNNNYNSKKLYYNI 327 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +2 Query: 50 SNYARKVHNNKYVLRKFYKKV 112 +NY K +NN Y +K Y + Sbjct: 318 NNYNYKNYNNNYNSKKLYYNI 338 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 230 HFEMLERCLTGYPLAINATDIKVKEV 307 H E L+ + G + N ++ VKE+ Sbjct: 238 HHEALQEAVPGDNVGFNVKNVSVKEL 263 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.5 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -2 Query: 232 VSILWVISFIIIF 194 V+ +W++SF+I F Sbjct: 186 VATVWILSFVICF 198 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 9.5 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +2 Query: 230 HFEMLERCLTGYPLAINATDIKVKEV 307 H E L+ + G + N ++ VKE+ Sbjct: 295 HHEALQEAVPGDNVGFNVKNVSVKEL 320 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 189,641 Number of Sequences: 438 Number of extensions: 4361 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -