BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30351.Seq (814 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5) 46 5e-05 SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51) 46 5e-05 SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 30 2.6 SB_25843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) 29 4.5 SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_44893| Best HMM Match : FGGY_C (HMM E-Value=2.5) Length = 85 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402 +Q+QAD+LGI V RP M E+TALGAA+ AG A + VW Sbjct: 25 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62 >SB_34143| Best HMM Match : FGGY_C (HMM E-Value=0.51) Length = 137 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402 +Q+QAD+LGI V RP M E+TALGAA+ AG A + VW Sbjct: 25 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 62 >SB_17612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 45.6 bits (103), Expect = 5e-05 Identities = 23/38 (60%), Positives = 29/38 (76%), Gaps = 2/38 (5%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRA--MRVW 402 +Q+QAD+LGI V RP M E+TALGAA+ AG A + VW Sbjct: 436 MQLQADILGISVERPTMPETTALGAAMAAGAAKGIEVW 473 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 29.9 bits (64), Expect = 2.6 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +2 Query: 476 LVYPVNQPASAQN*VLRH-PSVGEELPQGRAVCSHRVRHGARLVTHGPPAAGPGQYA 643 L+YP+ A L H P+ P A C + +RH A + H PP A YA Sbjct: 1038 LIYPIRHRALH----LPHTPARAASTPYATACCIYPIRHRALHLPHTPPHAASTPYA 1090 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/42 (33%), Positives = 19/42 (45%) Frame = +2 Query: 530 PSVGEELPQGRAVCSHRVRHGARLVTHGPPAAGPGQYAERRV 655 P P A+C + +RH A + H PP A YA R+ Sbjct: 941 PPHATSTPYATALCIYPIRHRALHLPHTPPHAASTSYATVRL 982 >SB_25843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 479 Score = 29.5 bits (63), Expect = 3.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -3 Query: 620 LEARVSPDARRGGRDGCRLRAPEATPRRRRDGAELSSVQ 504 +EAR + DA + RL E RRR GAE ++ Sbjct: 1 MEAREANDANKASNSAPRLSGSERNKRRREKGAESQRIE 39 >SB_21449| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 29.5 bits (63), Expect = 3.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 509 VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVW 402 +++ + L G + RP + + LGAA +AG A VW Sbjct: 21 MELTSSLTGQSMDRPSQTDMSVLGAAFLAGMATGVW 56 >SB_57710| Best HMM Match : bZIP_1 (HMM E-Value=0.32) Length = 584 Score = 29.1 bits (62), Expect = 4.5 Identities = 19/55 (34%), Positives = 25/55 (45%) Frame = +1 Query: 502 ICTELSSAPSLRRRGVASGARSLQPSRPPRRASGDTRASSGGPWTIC*TSSPFGS 666 +C+ PS V SG+R+ P+ P AS + SGGP SP GS Sbjct: 313 VCSANGETPSPMLTSVGSGSRTGSPAAPTNAASA-SPGKSGGPEE---RQSPMGS 363 >SB_23698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/23 (52%), Positives = 14/23 (60%), Gaps = 2/23 (8%) Frame = +3 Query: 363 QECIGRW--AGYCRGPHTHCATC 425 QEC+GRW A + RG H C C Sbjct: 26 QECLGRWNVAQFFRGRHPTCPHC 48 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +1 Query: 508 TELSSAPSLRRRGVASGARSLQPSRPP 588 T L++ PS R+ G +S A++ +PS PP Sbjct: 3156 TVLTTLPSSRQAGTSSTAKATRPSVPP 3182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,452,398 Number of Sequences: 59808 Number of extensions: 557043 Number of successful extensions: 1358 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1357 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -