BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30351.Seq (814 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 46 1e-06 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 24 4.8 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 6.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 6.4 AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 pr... 23 8.5 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 46.0 bits (104), Expect = 1e-06 Identities = 46/170 (27%), Positives = 68/170 (40%), Gaps = 14/170 (8%) Frame = -3 Query: 704 YWRKDARGVXLRFEPKGLDVQHIVQGPPLEARV--SPDARRGGRDGCRLRAPEATPRRRR 531 YWRKDARG+ +H LEA + D + C + + Sbjct: 370 YWRKDARGIFCGLT--SFTTKHHFVRAALEAVCFQTRDIIEAMKKDCGINLNKL----HT 423 Query: 530 DGAELSS---VQMQADLLGIPVIRPLMMESTALGAAIVAGRAMRVWPTTIPS-------- 384 DG S+ +Q+QADL GIPV+R + E ALG A+ A +A V + + Sbjct: 424 DGIMASNSLLMQLQADLSGIPVLRTEVHEPAALGTAMAAAQANGVDLYKLEAEIRGYAGV 483 Query: 383 -PPADTFLPALTNXXXXXXXXXXXEALNKCMGWTDTKNEHVNAENQIELL 237 +TFLP T A+ + +GW +K + + LL Sbjct: 484 QSHHETFLPTTTEEERNARYTKWKMAVQRSLGWAVSKKSEAMTDERYSLL 533 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 24.2 bits (50), Expect = 4.8 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -2 Query: 633 PGPAAGGPCVTRRAPWRTRWLQTARP*GNSSPTEGWRRTQ 514 P P P RRAP R R G + GWR+++ Sbjct: 161 PQPQPARPYRVRRAPRAERRHPYTRRSGGQQRSAGWRQSR 200 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 6.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 368 MYRPVGWVLSWATHALRDLRQW 433 +Y P + W H +RDLR W Sbjct: 556 LYMPNRERVLWPAHNVRDLRLW 577 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 6.4 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 368 MYRPVGWVLSWATHALRDLRQW 433 +Y P + W H +RDLR W Sbjct: 556 LYMPNRERVLWPAHNVRDLRLW 577 >AY745210-1|AAU93477.1| 86|Anopheles gambiae cytochrome P450 protein. Length = 86 Score = 23.4 bits (48), Expect = 8.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -2 Query: 420 SRNACVAHDNTQPTGRYIP 364 +R AC++ DN Q R++P Sbjct: 17 TRVACLSEDNFQQADRFLP 35 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 814,958 Number of Sequences: 2352 Number of extensions: 18186 Number of successful extensions: 41 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 86071221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -