BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30348.Seq (778 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 25 3.5 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 25 3.5 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 25 3.5 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 25 3.5 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 25 3.5 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 24 4.6 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 8.0 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 435 STHY*SFICQHSCDCFVQHRLPTKIVDIAIPCNTKS 542 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 435 STHY*SFICQHSCDCFVQHRLPTKIVDIAIPCNTKS 542 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 435 STHY*SFICQHSCDCFVQHRLPTKIVDIAIPCNTKS 542 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 435 STHY*SFICQHSCDCFVQHRLPTKIVDIAIPCNTKS 542 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 24.6 bits (51), Expect = 3.5 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 435 STHY*SFICQHSCDCFVQHRLPTKIVDIAIPCNTKS 542 S H I QHS QH P + IA P KS Sbjct: 48 SVHAAPAIYQHSAPAIYQHSAPAIVKTIAQPTIIKS 83 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 24.2 bits (50), Expect = 4.6 Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 2/76 (2%) Frame = +2 Query: 20 VVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTH--VIN 193 +VT+++ + G+D+LA +EDV + L E T +++RR DGT + Sbjct: 202 IVTEMAEVLITGIDMLA-KKEDVERGL----QRALERTAVAATTSLWERR-DGTQRARVR 255 Query: 194 LRRTWEKLVLAARAVV 241 L R L+L R VV Sbjct: 256 LPRRDTDLLLDKRIVV 271 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.4 bits (48), Expect = 8.0 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 456 ICQHSCDCFVQHRLPTKIVDIAIPCNTKS 542 I QHS QH P + IA P KS Sbjct: 79 IYQHSAPAIYQHSAPAIVKTIAQPTIIKS 107 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 868,368 Number of Sequences: 2352 Number of extensions: 19924 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81081585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -