BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30347.Seq (514 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal pro... 123 7e-29 U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical pr... 29 2.0 Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical pr... 27 6.0 U41542-2|AAR30212.1| 623|Caenorhabditis elegans Suppressor of p... 27 7.9 U41542-1|AAR30211.1| 684|Caenorhabditis elegans Suppressor of p... 27 7.9 >AF025460-6|AAB70989.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 22 protein. Length = 130 Score = 123 bits (297), Expect = 7e-29 Identities = 57/71 (80%), Positives = 65/71 (91%), Gaps = 1/71 (1%) Frame = +1 Query: 253 QIVVNLTGRLNKCGVISPRFDVPINDIERWTN-LLPSRQFGYLVLTTSGGIMDHEEARRK 429 +IVVNLTGRLNK VISPR ++ +ND+E++TN LLPSRQFGYL+LTTS GIMDHEEARRK Sbjct: 60 KIVVNLTGRLNKASVISPRLNIRLNDLEKYTNTLLPSRQFGYLILTTSAGIMDHEEARRK 119 Query: 430 HLGGKILGFFF 462 HLGGKILGFFF Sbjct: 120 HLGGKILGFFF 130 Score = 115 bits (276), Expect = 2e-26 Identities = 53/62 (85%), Positives = 60/62 (96%) Frame = +2 Query: 77 MVRMNVLSDALKSIHNAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGR 256 MVRMNVL+DAL +I+NAEKRGKRQVLIRP SKVIV+FLTVMMKHGYIGEFEIVDDHRAG+ Sbjct: 1 MVRMNVLADALNAINNAEKRGKRQVLIRPASKVIVRFLTVMMKHGYIGEFEIVDDHRAGK 60 Query: 257 LL 262 ++ Sbjct: 61 IV 62 >U00032-8|AAA50632.2| 1163|Caenorhabditis elegans Hypothetical protein F37A4.4 protein. Length = 1163 Score = 29.1 bits (62), Expect = 2.0 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 2/58 (3%) Frame = +2 Query: 89 NVLSDALKSIH--NAEKRGKRQVLIRPCSKVIVKFLTVMMKHGYIGEFEIVDDHRAGR 256 NVL D+++ I+ N K KR I C+K L V + GY EI+ H A R Sbjct: 826 NVLIDSVREINATNLLKAVKRGAYINVCNKYGNTALHVATRRGYQNLVEILIKHGADR 883 >Z81066-3|CAI46608.1| 363|Caenorhabditis elegans Hypothetical protein F17B5.6 protein. Length = 363 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/14 (64%), Positives = 10/14 (71%), Gaps = 1/14 (7%) Frame = +3 Query: 360 TTVWL-PSPYNKWW 398 T +WL P PYN WW Sbjct: 29 TVIWLIPRPYNYWW 42 >U41542-2|AAR30212.1| 623|Caenorhabditis elegans Suppressor of presenilin defectprotein 3, isoform b protein. Length = 623 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 86 YAPWLRFSSRFVANRIDRTVQKKKK 12 +A WLR+ R N +++ KKKK Sbjct: 323 FATWLRYERRINKNDLNKPTNKKKK 347 >U41542-1|AAR30211.1| 684|Caenorhabditis elegans Suppressor of presenilin defectprotein 3, isoform a protein. Length = 684 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = -3 Query: 86 YAPWLRFSSRFVANRIDRTVQKKKK 12 +A WLR+ R N +++ KKKK Sbjct: 323 FATWLRYERRINKNDLNKPTNKKKK 347 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,566,657 Number of Sequences: 27780 Number of extensions: 203229 Number of successful extensions: 463 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 450 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 985905834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -