BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30344.Seq (577 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) 97 1e-20 SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.6 SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) 29 3.6 SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.8 SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) 27 8.3 >SB_49958| Best HMM Match : Mak10 (HMM E-Value=7.7) Length = 176 Score = 96.7 bits (230), Expect = 1e-20 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = +1 Query: 61 MNVIQAVKMYITKMXXESGPGMKVILMDKETTSIVSMVYSQSEILQKEVYLFERIDS 231 MNVI AVK Y+TKM ESG GMKV+LMDKETT IVSMVYSQ+E+LQKEVYLFER+D+ Sbjct: 1 MNVILAVKQYVTKMIEESGAGMKVLLMDKETTGIVSMVYSQTEVLQKEVYLFERVDT 57 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +1 Query: 376 ADIKTLAECDDXXAVRXVHXVFADYPGXGXETCSLS 483 A I+ LAE DD VR V +ADY SL+ Sbjct: 77 ASIRALAEADDQEVVREVQEYYADYFAISPHVFSLN 112 >SB_34467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 524 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = -3 Query: 164 TMLVVSLSINITFIPGPLSXXILVMYIL--TACITFILIKLSLFIS 33 T + SLS ++TF+ GPL+ + Y + A + IL L LF S Sbjct: 57 TAWIASLSFSLTFMLGPLTTSLCTKYGVRSVAVLGAILFALGLFCS 102 >SB_12344| Best HMM Match : ATP-synt_B (HMM E-Value=1.9) Length = 341 Score = 28.7 bits (61), Expect = 3.6 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -1 Query: 334 YLGSLSSRDNRAM---FSDVGRIKTMHFMCSCYPIWHDCLSSRISKLPSVRFPID 179 YL SL R + ++ + + GR+ T+ +P + D ++ IS++P V P+D Sbjct: 207 YLRSLRKRQDMSVNTTWPNFGRVTTLVAQDMTFPSYDDVINDVISRVPFVDPPLD 261 >SB_41402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/77 (18%), Positives = 34/77 (44%) Frame = +1 Query: 25 ILCEINKDNLIKMNVIQAVKMYITKMXXESGPGMKVILMDKETTSIVSMVYSQSEILQKE 204 ++CE+ KD+ K + V + + K G ++ TT + + ++E+++ Sbjct: 15 LICELGKDDFKKTGLPMCVAIKLQKAIESLDKGKELKTSLDSTTIKANKILKKTELIELS 74 Query: 205 VYLFERIDSHAKWDNMN 255 E +++ W+ N Sbjct: 75 KKSLEAQFANSNWNEFN 91 >SB_59326| Best HMM Match : FtsX (HMM E-Value=2.2) Length = 238 Score = 27.5 bits (58), Expect = 8.3 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = -2 Query: 180 TVHHTHYAGSFFIH*YHFHSRAALXXHFSNVHFNCLY--HIHFD*IILI 40 ++HH + +F H Y++H + H + H + Y H H D I+I Sbjct: 79 SIHHRYR--DYFYHSYNYHHKWQHYHHHHHYHHHLDYDHHYHHDLFIII 125 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,076,732 Number of Sequences: 59808 Number of extensions: 286085 Number of successful extensions: 529 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 527 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -