BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30344.Seq (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical prote... 29 0.14 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 28 0.25 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 23 5.4 AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. 23 5.4 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 23 5.4 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 23 5.4 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 23 5.4 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 23 9.4 >AJ438610-6|CAD27478.1| 226|Anopheles gambiae hypothetical protein protein. Length = 226 Score = 28.7 bits (61), Expect = 0.14 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 261 KCIVFIRPTSENIALLSRELRDPKYGVYFIYXQ*CSF*GR 380 KC+ F RP S ALL+ E + Y + F + F GR Sbjct: 158 KCVPFCRPFSGQTALLTPESQSANYALTFAFTAPRVFVGR 197 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 27.9 bits (59), Expect = 0.25 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +3 Query: 174 VQSIGNLTEGSLLIREDRQSC 236 ++ +G T G ++IRED QSC Sbjct: 849 MKDVGEKTTGPIVIREDNQSC 869 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 417 SXXIITFGQSFDVCLRNYIT 358 S +T GQ+FD+ R Y++ Sbjct: 135 SDITLTIGQAFDLAYRRYVS 154 >AY341160-1|AAR13724.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 417 SXXIITFGQSFDVCLRNYIT 358 S +T GQ+FD+ R Y++ Sbjct: 135 SDITLTIGQAFDLAYRRYVS 154 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 417 SXXIITFGQSFDVCLRNYIT 358 S +T GQ+FD+ R Y++ Sbjct: 135 SDITLTIGQAFDLAYRRYVS 154 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 417 SXXIITFGQSFDVCLRNYIT 358 S +T GQ+FD+ R Y++ Sbjct: 135 SDITLTIGQAFDLAYRRYVS 154 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.4 bits (48), Expect = 5.4 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 417 SXXIITFGQSFDVCLRNYIT 358 S +T GQ+FD+ R Y++ Sbjct: 135 SDITLTIGQAFDLAYRRYVS 154 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/24 (33%), Positives = 17/24 (70%) Frame = +3 Query: 252 EHMKCIVFIRPTSENIALLSRELR 323 EH++ +V RPT+ N+ L + +++ Sbjct: 80 EHLQYLVTSRPTAVNLKLAADDVK 103 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 552,881 Number of Sequences: 2352 Number of extensions: 9798 Number of successful extensions: 12 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -