BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30342.Seq (789 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41180| Best HMM Match : DUF229 (HMM E-Value=0) 29 3.2 SB_59790| Best HMM Match : VWA (HMM E-Value=0) 28 9.9 >SB_41180| Best HMM Match : DUF229 (HMM E-Value=0) Length = 721 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = -2 Query: 713 PNFGVXXKXPGNXXXXGPGXXX--ESPGNSRXPKXPGYPENWEGPXHQ 576 P V K PG G G + PG+S K P + E+ +GP HQ Sbjct: 83 PGHLVEDKRPGQPIDEGSGNQVTDQRPGHSVKNKSPAHLEDDKGPGHQ 130 >SB_59790| Best HMM Match : VWA (HMM E-Value=0) Length = 4151 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +2 Query: 386 YLLNVRGGGKLIYRMTNPATTNAISRPTISSVNEIG 493 Y LNVR G + I R NP+ A RP + N G Sbjct: 468 YPLNVRYGARDISRSKNPSGRMANIRPAVGPDNRAG 503 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,350,365 Number of Sequences: 59808 Number of extensions: 406715 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 621 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -