BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30332.Seq (819 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5808| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 31 1.1 SB_49207| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_3663| Best HMM Match : MBT (HMM E-Value=0) 30 2.6 SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) 29 6.0 SB_43866| Best HMM Match : Gelsolin (HMM E-Value=0.092) 29 6.0 SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) 28 7.9 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) 28 7.9 >SB_5808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 34.3 bits (75), Expect = 0.12 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 216 AGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQ 350 A +KE ++ RK+++GKP+P+ K PTRK +K + + + Sbjct: 293 ATSNEKKEQEKERKKSEGKPKPRSEK-EKQPTRKRVKRPEKLNKR 336 >SB_52294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 394 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 136 YGVGVVNRYALFLDDETDPLDALKAREQ 219 Y +GV NR+ L L DE DP K E+ Sbjct: 6 YSIGVNNRFGLLLSDEEDPETTFKESEK 33 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTR-KGIKETQNVKSQDIKSGEQQK 377 KSA GEG + ++ +K N G K K +T + K +E + K Q I+ +++K Sbjct: 492 KSATGGEGKEAPAKKKQKHNDGDAPKKSKKKLTHEEKLKLAEEEKEKKKQQIQEDKEKK 550 >SB_49207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 219 GEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKG 320 G+ +QK+++ RK N+GKP P +K + + G Sbjct: 46 GKTSQKDEKPERKSNRGKPGPNDSKYIRLAKAGG 79 >SB_3663| Best HMM Match : MBT (HMM E-Value=0) Length = 327 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +3 Query: 207 SARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPT 311 SA + + ++E++ KE + KP+P+P +PT Sbjct: 158 SAASSDDEEEEEEEEEKEKEEKPKPEPELAPPLPT 192 >SB_53103| Best HMM Match : DUF1388 (HMM E-Value=0.29) Length = 462 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = +3 Query: 204 KSARAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQDIKSGEQQK 377 K AR + ++Q++ +E K + K A+ R+G K + K+++ + ++QK Sbjct: 99 KRARTETTRRGQEQKTPEEGKNRNHQKKARTENTRRRQGEKPPEEGKNRNTRKRQEQK 156 >SB_43866| Best HMM Match : Gelsolin (HMM E-Value=0.092) Length = 341 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +3 Query: 222 EGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQDIKSGEQQK 377 E QKE+ + + K + +PK AK T + K I+E + QD + E K Sbjct: 117 EEVQKEEDKDGEVEKSEEKPKEAKAETEESGK-IEEVETTTEQDKQPEEVVK 167 >SB_15999| Best HMM Match : LRR_1 (HMM E-Value=1.7e-21) Length = 791 Score = 28.3 bits (60), Expect = 7.9 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +3 Query: 207 SARAGEGAQ--KEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQDIKSGE 368 +A GE A +D + K +K K +P+ K VT+ + G+K VK + S + Sbjct: 135 NADYGEAASLTADDSTAHKSDK-KHDPEAKKQVTITVQPGVKPKPTVKKRSTPSAD 189 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 28.3 bits (60), Expect = 7.9 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +3 Query: 252 RKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQDIK-SGEQQKGKG 386 ++E + KP P P + KG E++ K + K GE +K KG Sbjct: 1490 KEEPEEKPSPSPKTANKSESEKGKGESEKDKGESEKDKGESEKDKG 1535 >SB_50891| Best HMM Match : CsbD (HMM E-Value=3.4) Length = 311 Score = 28.3 bits (60), Expect = 7.9 Identities = 16/57 (28%), Positives = 29/57 (50%) Frame = +3 Query: 213 RAGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQNVKSQDIKSGEQQKGK 383 + G+GA ++++ + K+ KG E + K T K+ Q +GEQ+KG+ Sbjct: 25 KEGKGATEQEKGAIKQGKGATEQE--KEATEQGNGASKQGTGASEQGKGAGEQEKGE 79 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,763,153 Number of Sequences: 59808 Number of extensions: 416201 Number of successful extensions: 1143 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1139 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2287608719 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -