BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30323.Seq (967 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 25 0.88 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 25 0.88 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.88 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 24 1.5 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 3.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 6.2 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 22 8.2 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 8.2 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 25.0 bits (52), Expect = 0.88 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -1 Query: 253 TLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHF 110 TLV H+ +++ S+ VW +L+ + D Y V N V F Sbjct: 219 TLVQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLIGDAYAVLNSVLF 266 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 25.0 bits (52), Expect = 0.88 Identities = 14/48 (29%), Positives = 22/48 (45%) Frame = -1 Query: 253 TLVDNHTESMSSHVVHATCLSMVYFVWHTLLNCTIASDVYNVSNFVHF 110 TLV H+ +++ S+ VW +L+ + D Y V N V F Sbjct: 219 TLVQMHSNLVTTSEEVCDSFSIFGLVWISLIFVVLIGDAYAVLNSVLF 266 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.88 Identities = 14/59 (23%), Positives = 21/59 (35%) Frame = +1 Query: 64 SQVPHTWNYSALHVHESVQSWRHCRHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSRCD 240 S + T +Y+ + E + SWR + G P S V +C CD Sbjct: 496 SHMQQTQHYTNIISQEQIISWRSSDDAKGGGGGSGSGNNQPPGGPSSHVSAVLTCKVCD 554 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 612 RRDWENPGRYPT*SPCSTSPFRQLGV 689 R++ PG PT +P +S ++LG+ Sbjct: 745 RQNSSFPGHGPTTAPMGSSILKRLGI 770 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 24.2 bits (50), Expect = 1.5 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = +1 Query: 31 GLPPRHQGLVRSQVPHTWNYSALHVHESVQSW 126 G+ H GL S V T N L V +++ W Sbjct: 215 GVTGHHSGLYPSAVDTTTNQKLLTVDAAIRGW 246 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 173 PHKVYHGKTGR 205 PH Y GKTGR Sbjct: 302 PHPTYFGKTGR 312 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 6.2 Identities = 8/19 (42%), Positives = 12/19 (63%), Gaps = 1/19 (5%) Frame = +1 Query: 73 PHT-WNYSALHVHESVQSW 126 PH W Y L+V++ +Q W Sbjct: 234 PHDQWAYEKLNVNDGLQLW 252 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 21.8 bits (44), Expect = 8.2 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = +1 Query: 223 SCSRCDCQQACRGRIIPKRINIR 291 +C RCD +Q R I + + + Sbjct: 63 NCERCDSRQVANARRIARYVQTK 85 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 8.2 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = -2 Query: 507 FYWTLRYEXVWDR 469 +YW +YE W R Sbjct: 120 YYWRQQYEDFWHR 132 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,056 Number of Sequences: 336 Number of extensions: 4607 Number of successful extensions: 17 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 27306312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -