BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30323.Seq (967 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) 135 4e-32 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 99 5e-21 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 96 3e-20 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 92 5e-19 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 91 2e-18 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 88 1e-17 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 1e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 3e-15 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 1e-12 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 3e-12 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 67 2e-11 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 67 2e-11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 67 2e-11 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 5e-11 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 9e-10 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 60 3e-09 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 8e-09 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 53 3e-07 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 52 5e-07 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 2e-06 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 50 4e-06 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 4e-06 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 7e-06 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 2e-05 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 46 3e-05 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 46 3e-05 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 46 6e-05 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 46 6e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 46 6e-05 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 46 6e-05 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 46 6e-05 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 46 6e-05 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 46 6e-05 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 46 6e-05 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 46 6e-05 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 46 6e-05 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 46 6e-05 SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) 45 8e-05 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 1e-04 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 45 1e-04 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 44 1e-04 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 44 1e-04 SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 44 1e-04 SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 44 2e-04 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 43 3e-04 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 43 3e-04 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 43 4e-04 SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) 43 4e-04 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 43 4e-04 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 43 4e-04 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 43 4e-04 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) 43 4e-04 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 4e-04 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 42 7e-04 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 42 7e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 42 7e-04 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 42 7e-04 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 42 7e-04 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 42 7e-04 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 42 7e-04 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 42 7e-04 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 42 7e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 42 7e-04 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 42 7e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 42 7e-04 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 42 7e-04 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 42 7e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 42 7e-04 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 42 7e-04 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 42 7e-04 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 42 7e-04 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 42 7e-04 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 42 7e-04 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 42 7e-04 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 42 7e-04 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 42 7e-04 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 42 7e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 42 7e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 42 7e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 42 7e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 42 7e-04 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 42 7e-04 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 42 7e-04 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 42 7e-04 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 42 7e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 42 7e-04 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 42 7e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 42 7e-04 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 42 7e-04 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 42 7e-04 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 42 7e-04 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 42 7e-04 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 42 7e-04 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 42 7e-04 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 42 7e-04 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 42 7e-04 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43709| Best HMM Match : NodZ (HMM E-Value=0.42) 42 7e-04 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 42 7e-04 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 42 7e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 42 7e-04 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 42 7e-04 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 42 7e-04 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 42 7e-04 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 42 7e-04 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 42 7e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 42 7e-04 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 42 7e-04 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 42 7e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 42 7e-04 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 42 7e-04 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 42 7e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 42 7e-04 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 42 7e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37438| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 42 7e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 >SB_40720| Best HMM Match : 7tm_3 (HMM E-Value=0) Length = 768 Score = 135 bits (327), Expect = 4e-32 Identities = 60/80 (75%), Positives = 70/80 (87%) Frame = +2 Query: 17 MTNSKGYRRGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGK 196 MTN+KGYRRGTR +F+++FR G LSTY+K YKVGDIVD++ NGAVQKGMPHKVYHGK Sbjct: 423 MTNTKGYRRGTRYMFSKKFRHRGVEHLSTYLKCYKVGDIVDVKANGAVQKGMPHKVYHGK 482 Query: 197 TGRVYNVTAHALGVIVNKRV 256 TGRVYNVT ALGV+VNK+V Sbjct: 483 TGRVYNVTKRALGVVVNKQV 502 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 107 bits (256), Expect = 2e-23 Identities = 47/56 (83%), Positives = 51/56 (91%) Frame = -2 Query: 726 VGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 559 VGKG+R G ++ PAGERGMCCKAIKLGNA+GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 5 VGKGDRCGLFAIT-PAGERGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 99.1 bits (236), Expect = 5e-21 Identities = 46/62 (74%), Positives = 50/62 (80%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRA 565 IQAA +G+ G ++ PAGERGMCCKAIKLGNA FPSHDVVKRRPVNCNTTHYRA Sbjct: 7 IQAAQLLGRAIGAGLFAIT-PAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRA 65 Query: 564 NW 559 NW Sbjct: 66 NW 67 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 96.3 bits (229), Expect = 3e-20 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -2 Query: 690 LXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 559 + PAGERGMCCKAIKLGNA FPSHDVVKRRPVNCNTTHYRANW Sbjct: 10 ITPAGERGMCCKAIKLGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 92.3 bits (219), Expect = 5e-19 Identities = 42/62 (67%), Positives = 49/62 (79%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRA 565 +QAA +G+ G ++ PAGERGMCCK+IKL +A FPSHDVVKRRPVNCNTTHYRA Sbjct: 1 MQAAQLLGRAIGAGLFAIT-PAGERGMCCKSIKLAHASVFPSHDVVKRRPVNCNTTHYRA 59 Query: 564 NW 559 NW Sbjct: 60 NW 61 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 90.6 bits (215), Expect = 2e-18 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -2 Query: 690 LXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRAN 562 + PAGERGMCCKAIKLGNA+GFPSHD KRRPVNCNTTHYRAN Sbjct: 55 ITPAGERGMCCKAIKLGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 87.8 bits (208), Expect = 1e-17 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +1 Query: 544 GGARYPIRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 GGA PIRPIVSRITIHWP+FYN TGKTL TQLNRLAAHPPFASW Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRLAAHPPFASW 80 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 87.0 bits (206), Expect = 2e-17 Identities = 43/62 (69%), Positives = 47/62 (75%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRA 565 IQAA +G+ G ++ PAGERGMCCKAIKL FPSHDVVKRRPVNCNTTHYRA Sbjct: 1840 IQAAQLLGRAIGAGLFAIT-PAGERGMCCKAIKLVTPV-FPSHDVVKRRPVNCNTTHYRA 1897 Query: 564 NW 559 NW Sbjct: 1898 NW 1899 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 81.4 bits (192), Expect = 1e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGKTL VTQLNRLAAHPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLNRLAAHPPFASW 37 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 81.0 bits (191), Expect = 1e-15 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = -2 Query: 675 ERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRAN 562 ERGMCCKAIKLGNA F SHDVVKRRPVNCNTTHYRAN Sbjct: 3 ERGMCCKAIKLGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 79.8 bits (188), Expect = 3e-15 Identities = 39/64 (60%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = -2 Query: 747 PIQAAXNVGKGNRYGPXSLLXPAGERGMCCKA-IKLGNAQGFPSHDVVKRRPVNCNTTHY 571 P QAA +G+ G ++ PAGE+G + +KLG QGFPSHDVVKRRPVNCNTTHY Sbjct: 40 PSQAAQLLGRAIGAGLFAIT-PAGEKGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHY 98 Query: 570 RANW 559 RANW Sbjct: 99 RANW 102 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 3e-15 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGK GVTQLNRLAAHPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASW 37 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 79.8 bits (188), Expect = 3e-15 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGK GVTQLNRLAAHPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRLAAHPPFASW 37 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 79.0 bits (186), Expect = 5e-15 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGK GVTQLNRLAAHPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRLAAHPPFASW 37 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 74.9 bits (176), Expect = 9e-14 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 592 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASW Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 35 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 74.9 bits (176), Expect = 9e-14 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNV+ KT GVTQLNRLAAHPPFASW Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRLAAHPPFASW 37 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 71.3 bits (167), Expect = 1e-12 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVV + GVTQLNRLAAHPPFASW Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRLAAHPPFASW 37 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 71.3 bits (167), Expect = 1e-12 Identities = 32/41 (78%), Positives = 33/41 (80%) Frame = +1 Query: 562 IRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 IRPIVSRITIHWPSFY + GV QLNRLAAHPPFASW Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQLNRLAAHPPFASW 58 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 69.7 bits (163), Expect = 3e-12 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGKTL + L LAAHPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASW 37 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 66.9 bits (156), Expect = 2e-11 Identities = 36/65 (55%), Positives = 41/65 (63%) Frame = -2 Query: 753 HSPIQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTH 574 HSP + N +G SLL + G C A +L + GFPSHDVVKRRPVNCNTTH Sbjct: 589 HSPFRLR-NCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTH 643 Query: 573 YRANW 559 YRANW Sbjct: 644 YRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 66.9 bits (156), Expect = 2e-11 Identities = 36/65 (55%), Positives = 41/65 (63%) Frame = -2 Query: 753 HSPIQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTH 574 HSP + N +G SLL + G C A +L + GFPSHDVVKRRPVNCNTTH Sbjct: 32 HSPFRLR-NCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTH 86 Query: 573 YRANW 559 YRANW Sbjct: 87 YRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 66.9 bits (156), Expect = 2e-11 Identities = 36/65 (55%), Positives = 41/65 (63%) Frame = -2 Query: 753 HSPIQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTH 574 HSP + N +G SLL + G C A +L + GFPSHDVVKRRPVNCNTTH Sbjct: 32 HSPFRLR-NCWEGRSVRASSLLRQLAKGG--CAARRL--SWGFPSHDVVKRRPVNCNTTH 86 Query: 573 YRANW 559 YRANW Sbjct: 87 YRANW 91 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 65.7 bits (153), Expect = 5e-11 Identities = 27/42 (64%), Positives = 33/42 (78%) Frame = -2 Query: 684 PAGERGMCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANW 559 P+G++ M ++ +A FPSHDVVKRRPVNCNTTHYRANW Sbjct: 18 PSGDKSMYSESNNKSHAIVFPSHDVVKRRPVNCNTTHYRANW 59 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.7 bits (153), Expect = 5e-11 Identities = 34/63 (53%), Positives = 38/63 (60%), Gaps = 1/63 (1%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLG-NAQGFPSHDVVKRRPVNCNTTHYR 568 +Q N +G SLL + G C A +L GFPSHDVVKRRPVNCNTTHYR Sbjct: 20 VQQLRNCWEGRSVRASSLLRQLAKGG--CAARRLSWVTPGFPSHDVVKRRPVNCNTTHYR 77 Query: 567 ANW 559 ANW Sbjct: 78 ANW 80 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 65.7 bits (153), Expect = 5e-11 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGKTL + L L HPPFASW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASW 37 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 61.7 bits (143), Expect = 9e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 630 GFPSHDVVKRRPVNCNTTHYRANW 559 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 61.7 bits (143), Expect = 9e-10 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = -2 Query: 630 GFPSHDVVKRRPVNCNTTHYRANW 559 GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 60.9 bits (141), Expect = 2e-09 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGKTL + L L PPFASW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASW 37 Score = 35.1 bits (77), Expect = 0.086 Identities = 21/44 (47%), Positives = 23/44 (52%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEW 754 GK ALPNLIALQHIP + NSE P + GEW Sbjct: 17 GKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSL-NGEW 59 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 60.1 bits (139), Expect = 3e-09 Identities = 33/56 (58%), Positives = 35/56 (62%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASWX**RXRPVPIALSNIXRSLN 744 SRITIHWPSFYNVVTGKTL + L L H P + RP PIAL RSLN Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPKQLRSLN 56 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 58.4 bits (135), Expect = 8e-09 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -2 Query: 666 MCCKAIKLGNAQGFPSHDVVKRRPVNCNTTHYRANWVPGPPSKFF 532 MCCKAIKLGNA+ FPSHDVVKRRPV + H + + PP+K F Sbjct: 1 MCCKAIKLGNARVFPSHDVVKRRPV--PSLHACRSTLEDPPNKIF 43 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 58.0 bits (134), Expect = 1e-08 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 574 VSRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 +SRITIHWPS + GVTQLNRLAAHPPFASW Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRLAAHPPFASW 313 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 57.6 bits (133), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 607 YNVVTGKTLGVTQLNRLAAHPPFASW 684 YNVVTGKT GVTQLNRLAAHPPFASW Sbjct: 12 YNVVTGKTPGVTQLNRLAAHPPFASW 37 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 54.0 bits (124), Expect = 2e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = -1 Query: 682 SWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 SWRKGDVLQG PGFSQSRRCKTTASEL Sbjct: 19 SWRKGDVLQGRLSWVTPGFSQSRRCKTTASEL 50 Score = 29.1 bits (62), Expect = 5.6 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -3 Query: 704 GLXRYYXQLAKGGCAARRLSWVTP 633 G RYY KG RLSWVTP Sbjct: 12 GPLRYYASWRKGDVLQGRLSWVTP 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 53.2 bits (122), Expect = 3e-07 Identities = 30/47 (63%), Positives = 30/47 (63%) Frame = +1 Query: 544 GGARYPIRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 GGA PIRPIVS ITIHWPSFYN VT AHPPFASW Sbjct: 38 GGA--PIRPIVSHITIHWPSFYNGVT-------------AHPPFASW 69 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 53.2 bits (122), Expect = 3e-07 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 562 IRPIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHP 669 +RP+VSRITIHW SFYNVVTGKTL + L L P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEW 754 GK ALPNLIALQHIPLSPAG +E P + GEW Sbjct: 53 GKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSL-NGEW 95 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 52.4 bits (120), Expect = 5e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 618 HDVVKRRPVNCNTTHYRANW 559 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 52.4 bits (120), Expect = 5e-07 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -2 Query: 618 HDVVKRRPVNCNTTHYRANW 559 HDVVKRRPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_57792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 50.8 bits (116), Expect = 2e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 610 NVVTGKTLGVTQLNRLAAHPPFASW 684 N VTGKT GVTQLNRLAAHPPFA+W Sbjct: 8 NDVTGKTPGVTQLNRLAAHPPFANW 32 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 50.8 bits (116), Expect = 2e-06 Identities = 24/35 (68%), Positives = 26/35 (74%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHPPFAS 681 SRITIHWPSFYNVVTGKTL + L L P +AS Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYAS 36 Score = 29.5 bits (63), Expect = 4.3 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEW 754 GK ALPNL L+HIPL + SE P + GEW Sbjct: 17 GKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSL-NGEW 59 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 50.8 bits (116), Expect = 2e-06 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = -1 Query: 682 SWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 SWRKGDVLQ PGFSQSRRCKTTASEL Sbjct: 19 SWRKGDVLQRRLSWVTPGFSQSRRCKTTASEL 50 Score = 32.3 bits (70), Expect = 0.61 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = -3 Query: 731 KMLERAIGTGLXRYYXQLAKGGCAARRLSWVTP 633 ++L + G RYY KG RRLSWVTP Sbjct: 3 QLLGKGDRCGPLRYYASWRKGDVLQRRLSWVTP 35 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 50.8 bits (116), Expect = 2e-06 Identities = 23/34 (67%), Positives = 25/34 (73%) Frame = +1 Query: 568 PIVSRITIHWPSFYNVVTGKTLGVTQLNRLAAHP 669 P +SRITIHWPSFYNVVTGKTL + L L P Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIP 110 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/44 (54%), Positives = 26/44 (59%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEW 754 GK ALPNLIALQHIPLSPAG + E P + GEW Sbjct: 95 GKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSL-NGEW 137 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/25 (88%), Positives = 22/25 (88%) Frame = -2 Query: 666 MCCKAIKLGNAQGFPSHDVVKRRPV 592 MC KAIKLGNA FPSHDVVKRRPV Sbjct: 1 MCSKAIKLGNASVFPSHDVVKRRPV 25 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 49.6 bits (113), Expect = 4e-06 Identities = 25/41 (60%), Positives = 30/41 (73%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLGNAQGFP 622 IQAA +G+ G ++ PAGERGMCCKAIKLGNA+ FP Sbjct: 14 IQAAQLLGRAIGAGLFAIT-PAGERGMCCKAIKLGNARVFP 53 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 49.6 bits (113), Expect = 4e-06 Identities = 26/47 (55%), Positives = 30/47 (63%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEWQIV 763 GK ALPNLIALQHIPLSPAG NSE P + GEW+++ Sbjct: 15 GKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSL-NGEWRLM 60 Score = 39.1 bits (87), Expect = 0.005 Identities = 17/26 (65%), Positives = 18/26 (69%) Frame = +1 Query: 592 HWPSFYNVVTGKTLGVTQLNRLAAHP 669 HWPSFYNVVTGKTL + L L P Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIP 30 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.2 bits (112), Expect = 5e-06 Identities = 28/57 (49%), Positives = 33/57 (57%) Frame = -1 Query: 757 LPFANSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 +P A S CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 76 MPEAVSGLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 100 QLAKGGCAARRLSWVTP 116 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 48.8 bits (111), Expect = 7e-06 Identities = 23/32 (71%), Positives = 23/32 (71%) Frame = -1 Query: 682 SWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 SWRKGD G PGFSQSRRCKTTASEL Sbjct: 48 SWRKGDATASRLSGATPGFSQSRRCKTTASEL 79 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 48.4 bits (110), Expect = 9e-06 Identities = 29/57 (50%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = -1 Query: 754 PFANSSCXK-CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 P ANS+ + CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 187 PSANSNKLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 211 QLAKGGCAARRLSWVTP 227 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 48.0 bits (109), Expect = 1e-05 Identities = 22/31 (70%), Positives = 23/31 (74%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLGVTQLNRLAAHP 669 SRITIHWPSFYNVVTGKTL + L L P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIP 32 Score = 48.0 bits (109), Expect = 1e-05 Identities = 26/44 (59%), Positives = 27/44 (61%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEW 754 GK ALPNLIALQHIPLSPAG NSE P + GEW Sbjct: 17 GKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSL-NGEW 59 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +1 Query: 592 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWX**RXRPVPIALSN 726 HWPSFYNVVTGKTL + L L H P + RP PIAL N Sbjct: 62 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPN 105 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSE-XGPYRLP 718 GK ALPNLIALQHIPLSPAG ++ P LP Sbjct: 72 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 104 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 47.6 bits (108), Expect = 2e-05 Identities = 25/45 (55%), Positives = 27/45 (60%) Frame = +1 Query: 592 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASWX**RXRPVPIALSN 726 HWPSFYNVVTGKTL + L L H P + RP PIAL N Sbjct: 57 HWPSFYNVVTGKTLALPNLIAL-QHIPLSPAGVIAKRPAPIALPN 100 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSE-XGPYRLP 718 GK ALPNLIALQHIPLSPAG ++ P LP Sbjct: 67 GKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 99 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -1 Query: 742 SSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 S CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 356 SGLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 375 QLAKGGCAARRLSWVTP 391 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 46.4 bits (105), Expect = 3e-05 Identities = 26/56 (46%), Positives = 30/56 (53%) Frame = -1 Query: 754 PFANSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 P CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 246 PVNREKLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 269 QLAKGGCAARRLSWVTP 285 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/37 (64%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +1 Query: 577 SRITIHWPSFYNVVTGKTLG-VTQLNRLAAHPPFASW 684 SRITIHWPSFYNVVTGK G L L P ASW Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSLFDLQYIPLVASW 38 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 46.0 bits (104), Expect = 5e-05 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = +1 Query: 592 HWPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 HWPSFYN VTGKTL + L L P FASW Sbjct: 5 HWPSFYNDVTGKTLALPNLIALQHIPTFASW 35 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +2 Query: 623 GKPWALPNLIALQHIPLSPAGXNSE 697 GK ALPNLIALQHIP + NS+ Sbjct: 15 GKTLALPNLIALQHIPTFASWRNSQ 39 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 224 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 238 QLAKGGCAARRLSWVTP 254 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 892 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 906 QLAKGGCAARRLSWVTP 922 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 379 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 393 QLAKGGCAARRLSWVTP 409 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 228 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 242 QLAKGGCAARRLSWVTP 258 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 295 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 309 QLAKGGCAARRLSWVTP 325 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 35 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 49 QLAKGGCAARRLSWVTP 65 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 271 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 285 QLAKGGCAARRLSWVTP 301 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 244 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 258 QLAKGGCAARRLSWVTP 274 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 269 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 283 QLAKGGCAARRLSWVTP 299 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 453 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 467 QLAKGGCAARRLSWVTP 483 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 122 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 136 QLAKGGCAARRLSWVTP 152 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 288 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 302 QLAKGGCAARRLSWVTP 318 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 138 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 152 QLAKGGCAARRLSWVTP 168 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 589 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 603 QLAKGGCAARRLSWVTP 619 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 225 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 239 QLAKGGCAARRLSWVTP 255 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 503 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 517 QLAKGGCAARRLSWVTP 533 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 394 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 408 QLAKGGCAARRLSWVTP 424 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 45.6 bits (103), Expect = 6e-05 Identities = 25/47 (53%), Positives = 29/47 (61%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 CW+G+SVRA ++ KG PGFSQSRRCKTTASEL Sbjct: 187 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 201 QLAKGGCAARRLSWVTP 217 >SB_45900| Best HMM Match : Chordopox_A13L (HMM E-Value=7.4) Length = 152 Score = 45.2 bits (102), Expect = 8e-05 Identities = 27/53 (50%), Positives = 30/53 (56%), Gaps = 7/53 (13%) Frame = +1 Query: 547 GARYPIRPIVSRITIHWPSFYNVVT-------GKTLGVTQLNRLAAHPPFASW 684 G YP P SR H S+YN + + GVTQLNRLAAHPPFASW Sbjct: 42 GLNYPFVPKSSR---HSESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 >SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/35 (65%), Positives = 25/35 (71%) Frame = +2 Query: 590 FTGRRFTTS*LGKPWALPNLIALQHIPLSPAGXNS 694 +TGRRFTT GK ALPNLIALQHIP + NS Sbjct: 54 WTGRRFTTLVTGKTLALPNLIALQHIPHFASWRNS 88 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.8 bits (101), Expect = 1e-04 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL*YDSL 572 CW+G+SVRA ++ KG PGFSQSRRCKTTASE D L Sbjct: 12 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 98 GVTQLNRLAAHPPFASW 114 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 26 QLAKGGCAARRLSWVTP 42 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 135 >SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) Length = 1160 Score = 44.8 bits (101), Expect = 1e-04 Identities = 25/51 (49%), Positives = 30/51 (58%) Frame = -1 Query: 745 NSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 +SS CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 851 SSSLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 900 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 871 QLAKGGCAARRLSWVTP 887 >SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) Length = 282 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +1 Query: 595 WPSFYNVVTGKTLGVTQLNRLAAHPPFASW 684 WPS YN GVTQLNRL AH PF SW Sbjct: 218 WPSIYNDRDWNNSGVTQLNRLVAHLPFVSW 247 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 622 GKTLGVTQLNRLAAHPPFASW 684 G+ GVTQLNRLAAHPPFASW Sbjct: 38 GENTGVTQLNRLAAHPPFASW 58 Score = 29.9 bits (64), Expect = 3.2 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRD EN G + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/48 (54%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASWX**RXRPVPIALSNIXRSLN--WRMANCXVN 771 GVTQLNRLAAHPPFASW S RSLN WR+ C N Sbjct: 66 GVTQLNRLAAHPPFASWRNSEEARTD-RPSQQLRSLNGEWRLMRCGQN 112 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 103 >SB_29284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 622 GKTLGVTQLNRLAAHPPFASW 684 G+ GVTQLNRLAAHPPFASW Sbjct: 63 GENTGVTQLNRLAAHPPFASW 83 Score = 29.9 bits (64), Expect = 3.2 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRD EN G + PF + +ARTD P Q QL NG+ Sbjct: 54 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 104 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 622 GKTLGVTQLNRLAAHPPFASW 684 G+ GVTQLNRLAAHPPFASW Sbjct: 704 GENTGVTQLNRLAAHPPFASW 724 Score = 29.9 bits (64), Expect = 3.2 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRD EN G + PF + +ARTD P Q QL NG+ Sbjct: 695 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 745 >SB_1324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 622 GKTLGVTQLNRLAAHPPFASW 684 G+ GVTQLNRLAAHPPFASW Sbjct: 75 GENTGVTQLNRLAAHPPFASW 95 Score = 29.9 bits (64), Expect = 3.2 Identities = 24/55 (43%), Positives = 28/55 (50%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRD EN G + PF + +ARTD P Q QL NG+ Sbjct: 66 LAVVLQRRDGENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 116 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 44.0 bits (99), Expect = 2e-04 Identities = 22/39 (56%), Positives = 26/39 (66%), Gaps = 7/39 (17%) Frame = +1 Query: 589 IHWPSFYNVVT-------GKTLGVTQLNRLAAHPPFASW 684 IH+ S+YN + + GVTQLNRLAAHPPFASW Sbjct: 1464 IHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 1502 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 44.0 bits (99), Expect = 2e-04 Identities = 25/52 (48%), Positives = 29/52 (55%), Gaps = 2/52 (3%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASWX**RXRPVPIALSNIXRSLN--WRMANCXVNILLK 783 GVTQLNRLAAHPPFASW S RSLN WR+ C + + + Sbjct: 183 GVTQLNRLAAHPPFASWRNSEEARTD-RPSQQLRSLNGEWRLMRCDKSFIFR 233 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 220 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASE 590 CW+G+SVRA ++ KG PGFSQSRRCKTTASE Sbjct: 534 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 548 QLAKGGCAARRLSWVTP 564 >SB_38217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 625 KTLGVTQLNRLAAHPPFASW 684 K GVTQLNRLAAHPPFASW Sbjct: 18 KNTGVTQLNRLAAHPPFASW 37 Score = 33.5 bits (73), Expect = 0.26 Identities = 24/55 (43%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDW+N G + PF + +ARTD P Q QL NG+ Sbjct: 8 LAVVLQRRDWKNTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 58 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/39 (48%), Positives = 26/39 (66%) Frame = -3 Query: 749 RQFKLRKMLERAIGTGLXRYYXQLAKGGCAARRLSWVTP 633 +Q ++++ ++ G RYY KGGCAARRLSWVTP Sbjct: 57 QQTFVKQVTQQGDRCGPLRYYASWRKGGCAARRLSWVTP 95 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/32 (65%), Positives = 21/32 (65%) Frame = -1 Query: 682 SWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 SWRKG PGFSQSRRCKTTASEL Sbjct: 79 SWRKGGCAARRLSWVTPGFSQSRRCKTTASEL 110 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 43.6 bits (98), Expect = 2e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +1 Query: 622 GKTLGVTQLNRLAAHPPFASW 684 G+ GVTQLNRLAAHPPFASW Sbjct: 38 GENPGVTQLNRLAAHPPFASW 58 Score = 33.1 bits (72), Expect = 0.35 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRD ENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDGENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/45 (51%), Positives = 28/45 (62%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA +++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRA-YSLFRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 689 YXQLAKGGCAARRLSWVTP 633 + QLAKGGCAARRLSWVTP Sbjct: 17 FRQLAKGGCAARRLSWVTP 35 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/51 (47%), Positives = 29/51 (56%) Frame = -1 Query: 745 NSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 N + CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 126 NITLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 146 QLAKGGCAARRLSWVTP 162 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 43.2 bits (97), Expect = 3e-04 Identities = 26/79 (32%), Positives = 36/79 (45%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTPRVFPVTTL*NDGQ*IVIRLTIGRIGYRAPPRSFFXVXXFLKNF 504 QLAKGGCAARRLSWVTP + L + G P R+ + Sbjct: 117 QLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGPKRNLLLLIRVRFLE 176 Query: 503 IGLYATNXYGIGASKTGFS 447 +G + N + IG ++ F+ Sbjct: 177 LGRHRENVHKIGTCRSAFN 195 Score = 42.3 bits (95), Expect = 6e-04 Identities = 26/56 (46%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = -1 Query: 757 LPF-ANSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 +PF A CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 92 IPFVALLKLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/50 (48%), Positives = 29/50 (58%) Frame = -1 Query: 742 SSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 S+ CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 54 STLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 73 QLAKGGCAARRLSWVTP 89 >SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) Length = 2049 Score = 43.2 bits (97), Expect = 3e-04 Identities = 24/54 (44%), Positives = 30/54 (55%) Frame = -1 Query: 748 ANSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 + S+ CW+G+SVRA ++ KG PGFSQSRRCKTTA L Sbjct: 1850 SRSALRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAKAL 1902 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 1871 QLAKGGCAARRLSWVTP 1887 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 43.2 bits (97), Expect = 3e-04 Identities = 28/55 (50%), Positives = 31/55 (56%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF G + KARTD P Q QL NG+ Sbjct: 131 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEKARTDRPSQ---QLRSLNGE 181 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 144 GVTQLNRLAAHPPFASW 160 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -1 Query: 757 LPFANSSCX--KCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 LP ++C CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 138 LPETVTACLLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 164 QLAKGGCAARRLSWVTP 180 >SB_38216| Best HMM Match : APOBEC_C (HMM E-Value=7.3) Length = 340 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 4/57 (7%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLG----NAQGFPSHDVVKRRPVNC 586 IQAA +G+ G ++ PAGERGMCCKAIKLG N + +++ ++ V+C Sbjct: 7 IQAAQLLGRAIGAGLFAIT-PAGERGMCCKAIKLGVNGTNCENDSTNNAIEPTAVDC 62 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -1 Query: 757 LPFANSSCX--KCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 LP ++C CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 781 LPETVTACLLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 807 QLAKGGCAARRLSWVTP 823 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 42.7 bits (96), Expect = 4e-04 Identities = 26/57 (45%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -1 Query: 757 LPFANSSCX--KCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 LP ++C CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 363 LPETVTACLLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 389 QLAKGGCAARRLSWVTP 405 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/57 (42%), Positives = 30/57 (52%) Frame = -1 Query: 763 YNLPFANSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 Y++ CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 1097 YDVTARRGRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 1123 QLAKGGCAARRLSWVTP 1139 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -1 Query: 745 NSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 N CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 484 NPRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 504 QLAKGGCAARRLSWVTP 520 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 42.7 bits (96), Expect = 4e-04 Identities = 24/46 (52%), Positives = 28/46 (60%) Frame = -1 Query: 724 WKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTASEL 587 WKG+SVR +++ KG PGFSQSRRCKTTASEL Sbjct: 332 WKGRSVRT-YSLLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 Score = 39.5 bits (88), Expect = 0.004 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QL KGGCAARRLSWVTP Sbjct: 345 QLVKGGCAARRLSWVTP 361 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 42.7 bits (96), Expect = 4e-04 Identities = 27/54 (50%), Positives = 28/54 (51%), Gaps = 2/54 (3%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASWX**RXRPVPIALSNIXRSLN--WRMANCXVNILLKFG 789 GVTQLNRLAAHPPFASW S RSLN WR+ I L G Sbjct: 542 GVTQLNRLAAHPPFASWRNSEEARTD-RPSQQLRSLNGEWRLMRARYTITLCIG 594 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 579 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/42 (50%), Positives = 28/42 (66%), Gaps = 3/42 (7%) Frame = +1 Query: 568 PIVSRITIHWPSFYNVVTGKTL---GVTQLNRLAAHPPFASW 684 P++ R+ ++ S V+ + GVTQLNRLAAHPPFASW Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASW 91 >SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) Length = 85 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = +2 Query: 626 KPWALPNLIALQHIPLSPAGXNSEXGPYRLPFPTFXAA*IGEW 754 K ALPNLIALQH+PLSPAG + P + P + GEW Sbjct: 4 KTLALPNLIALQHVPLSPAGVIPKR-PAPIALPNMLRSLNGEW 45 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 42.7 bits (96), Expect = 4e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = +1 Query: 625 KTLGVTQLNRLAAHPPFASW 684 K GVTQLNRLAAHPPFASW Sbjct: 49 KNPGVTQLNRLAAHPPFASW 68 Score = 37.1 bits (82), Expect = 0.021 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDW+NPG + PF + +ARTD P Q QL NGK Sbjct: 39 LAVVLQRRDWKNPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLLSLNGK 89 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 42.3 bits (95), Expect = 6e-04 Identities = 29/68 (42%), Positives = 36/68 (52%), Gaps = 6/68 (8%) Frame = -2 Query: 744 IQAAXNVGKGNRYGPXSLLXPAGERGMCCKAIKLG------NAQGFPSHDVVKRRPVNCN 583 IQAA +G+ G ++ PAGERGMCCKAIKLG N Q V+ N + Sbjct: 1949 IQAAQLLGRAIGAGLFAIT-PAGERGMCCKAIKLGRCPVQQNIQTLIPECNVQYSWSNED 2007 Query: 582 TTHYRANW 559 T Y+ NW Sbjct: 2008 TEPYQTNW 2015 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 42.3 bits (95), Expect = 6e-04 Identities = 23/52 (44%), Positives = 30/52 (57%) Frame = -1 Query: 748 ANSSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 +++ CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 220 SSTGLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 241 QLAKGGCAARRLSWVTP 257 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/37 (56%), Positives = 25/37 (67%), Gaps = 7/37 (18%) Frame = +1 Query: 595 WPSFYNVVTG-------KTLGVTQLNRLAAHPPFASW 684 + S+YN + G + GVTQLNRLAAHPPFASW Sbjct: 45 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASW 81 Score = 35.5 bits (78), Expect = 0.065 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LA VLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 52 LAGVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 102 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 42.3 bits (95), Expect = 6e-04 Identities = 24/50 (48%), Positives = 28/50 (56%) Frame = -1 Query: 742 SSCXKCWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 S CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 109 SRLRNCWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 128 QLAKGGCAARRLSWVTP 144 >SB_51296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 42.3 bits (95), Expect = 6e-04 Identities = 17/20 (85%), Positives = 18/20 (90%) Frame = +1 Query: 625 KTLGVTQLNRLAAHPPFASW 684 K G+TQLNRLAAHPPFASW Sbjct: 25 KNPGITQLNRLAAHPPFASW 44 Score = 33.5 bits (73), Expect = 0.26 Identities = 20/44 (45%), Positives = 24/44 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQ 725 LAVVLQRRDW+NPG + PF + + RTD P Q Sbjct: 15 LAVVLQRRDWKNPGITQLNRLAAHPPFASWR-NSEETRTDRPSQ 57 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.3 bits (95), Expect = 6e-04 Identities = 21/37 (56%), Positives = 25/37 (67%), Gaps = 7/37 (18%) Frame = +1 Query: 595 WPSFYNVVTG-------KTLGVTQLNRLAAHPPFASW 684 + S+YN + G + GVTQLNRLAAHPPFASW Sbjct: 58 YESYYNSLAGVLQRRDWENPGVTQLNRLAAHPPFASW 94 Score = 35.5 bits (78), Expect = 0.065 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LA VLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 65 LAGVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 115 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 480 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 494 QLAKGGCAARRLSWVTP 510 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 48 GVTQLNRLAAHPPFASW 64 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 85 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 28 GVTQLNRLAAHPPFASW 44 Score = 31.9 bits (69), Expect = 0.80 Identities = 22/51 (43%), Positives = 26/51 (50%) Frame = +3 Query: 606 LQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 19 LQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 65 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 75 GVTQLNRLAAHPPFASW 91 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 112 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 57 GVTQLNRLAAHPPFASW 73 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 94 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 49 GVTQLNRLAAHPPFASW 65 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 86 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 75 GVTQLNRLAAHPPFASW 91 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 112 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 55 GVTQLNRLAAHPPFASW 71 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWEN G + PF + +ARTD P Q QL NG+ Sbjct: 42 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 92 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 80 GVTQLNRLAAHPPFASW 96 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 117 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 51 GVTQLNRLAAHPPFASW 67 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 88 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 71 GVTQLNRLAAHPPFASW 87 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 108 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 83 GVTQLNRLAAHPPFASW 99 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 120 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 27 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 41 QLAKGGCAARRLSWVTP 57 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 59 GVTQLNRLAAHPPFASW 75 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 96 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 48 GVTQLNRLAAHPPFASW 64 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 85 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 38 GVTQLNRLAAHPPFASW 54 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 75 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 63 GVTQLNRLAAHPPFASW 79 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 100 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 72 GVTQLNRLAAHPPFASW 88 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 109 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 66 GVTQLNRLAAHPPFASW 82 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 103 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 82 GVTQLNRLAAHPPFASW 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 119 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 70 GVTQLNRLAAHPPFASW 86 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 107 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 53 GVTQLNRLAAHPPFASW 69 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 90 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWEN G + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 53 GVTQLNRLAAHPPFASW 69 Score = 28.3 bits (60), Expect = 9.9 Identities = 20/49 (40%), Positives = 24/49 (48%) Frame = +3 Query: 612 RRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 RRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 46 RRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 90 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 229 GVTQLNRLAAHPPFASW 245 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 216 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 266 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 124 GVTQLNRLAAHPPFASW 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 161 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 62 GVTQLNRLAAHPPFASW 78 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 99 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 41 GVTQLNRLAAHPPFASW 57 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 78 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 29 GVTQLNRLAAHPPFASW 45 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 66 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 60 GVTQLNRLAAHPPFASW 76 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 97 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 394 GVTQLNRLAAHPPFASW 410 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 381 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 431 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 120 GVTQLNRLAAHPPFASW 136 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 157 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 96 GVTQLNRLAAHPPFASW 112 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 133 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 52 GVTQLNRLAAHPPFASW 68 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 89 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 21 GVTQLNRLAAHPPFASW 37 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 8 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 58 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 31 GVTQLNRLAAHPPFASW 47 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 68 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 51 GVTQLNRLAAHPPFASW 67 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 88 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 116 GVTQLNRLAAHPPFASW 132 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 103 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 153 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 58 GVTQLNRLAAHPPFASW 74 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 95 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 353 GVTQLNRLAAHPPFASW 369 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 340 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 390 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 93 GVTQLNRLAAHPPFASW 109 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 80 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 130 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 63 GVTQLNRLAAHPPFASW 79 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 100 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 29 GVTQLNRLAAHPPFASW 45 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 66 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 72 GVTQLNRLAAHPPFASW 88 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 109 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 56 GVTQLNRLAAHPPFASW 72 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 93 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 147 GVTQLNRLAAHPPFASW 163 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 184 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 76 GVTQLNRLAAHPPFASW 92 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 113 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 52 GVTQLNRLAAHPPFASW 68 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 89 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 156 GVTQLNRLAAHPPFASW 172 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 143 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 193 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 846 GVTQLNRLAAHPPFASW 862 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/75 (41%), Positives = 36/75 (48%) Frame = +3 Query: 534 KTSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTD 713 K SRG P+ LAVVLQRRDWENPG + PF + +ARTD Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTD 871 Query: 714 CPFQHFXQLELANGK 758 P Q QL NG+ Sbjct: 872 RPSQ---QLRSLNGE 883 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 29 GVTQLNRLAAHPPFASW 45 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 66 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 73 GVTQLNRLAAHPPFASW 89 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 110 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 47 GVTQLNRLAAHPPFASW 63 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 84 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 86 GVTQLNRLAAHPPFASW 102 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 123 >SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 48 GVTQLNRLAAHPPFASW 64 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWEN G + PF + +ARTD P Q QL NG+ Sbjct: 35 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 85 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 80 GVTQLNRLAAHPPFASW 96 Score = 41.5 bits (93), Expect = 0.001 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF G + +ARTD P Q QL NG+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWG-NSEEARTDRPSQ---QLRSLNGE 117 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 69 GVTQLNRLAAHPPFASW 85 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 106 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 82 GVTQLNRLAAHPPFASW 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 119 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 78 GVTQLNRLAAHPPFASW 94 Score = 35.5 bits (78), Expect = 0.065 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQR DWENPG + PF + +ARTD P Q QL NG+ Sbjct: 65 LAVVLQRLDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 115 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 269 GVTQLNRLAAHPPFASW 285 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 256 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 306 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWEN G + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 127 GVTQLNRLAAHPPFASW 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 164 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 63 GVTQLNRLAAHPPFASW 79 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 100 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 371 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 385 QLAKGGCAARRLSWVTP 401 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 49 GVTQLNRLAAHPPFASW 65 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 86 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 50 GVTQLNRLAAHPPFASW 66 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 87 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 114 GVTQLNRLAAHPPFASW 130 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 101 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 151 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 127 GVTQLNRLAAHPPFASW 143 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 164 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 52 GVTQLNRLAAHPPFASW 68 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 89 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 33 GVTQLNRLAAHPPFASW 49 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 70 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 71 GVTQLNRLAAHPPFASW 87 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 108 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 50 GVTQLNRLAAHPPFASW 66 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 87 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 47 GVTQLNRLAAHPPFASW 63 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 84 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 24 GVTQLNRLAAHPPFASW 40 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 61 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 32 GVTQLNRLAAHPPFASW 48 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 69 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 409 GVTQLNRLAAHPPFASW 425 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 396 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 446 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 58 GVTQLNRLAAHPPFASW 74 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 45 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 95 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 67 GVTQLNRLAAHPPFASW 83 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 104 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 49 GVTQLNRLAAHPPFASW 65 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 86 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 132 GVTQLNRLAAHPPFASW 148 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 169 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 68 GVTQLNRLAAHPPFASW 84 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 105 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 78 GVTQLNRLAAHPPFASW 94 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 115 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 81 GVTQLNRLAAHPPFASW 97 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 118 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 27 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 41 QLAKGGCAARRLSWVTP 57 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 427 GVTQLNRLAAHPPFASW 443 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 414 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 464 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 124 GVTQLNRLAAHPPFASW 140 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 111 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 161 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 80 GVTQLNRLAAHPPFASW 96 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 117 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 69 GVTQLNRLAAHPPFASW 85 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 106 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 59 GVTQLNRLAAHPPFASW 75 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 96 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWEN G + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 62 GVTQLNRLAAHPPFASW 78 Score = 38.7 bits (86), Expect = 0.007 Identities = 27/55 (49%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF KARTD P Q QL NG+ Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NNEKARTDRPSQ---QLRSLNGE 99 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 174 GVTQLNRLAAHPPFASW 190 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 211 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 78 GVTQLNRLAAHPPFASW 94 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 115 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 65 GVTQLNRLAAHPPFASW 81 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 102 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 101 GVTQLNRLAAHPPFASW 117 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 138 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 67 GVTQLNRLAAHPPFASW 83 Score = 35.1 bits (77), Expect = 0.086 Identities = 25/55 (45%), Positives = 29/55 (52%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWEN G + PF + +ARTD P Q QL NG+ Sbjct: 54 LAVVLQRRDWENTGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 104 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 50 GVTQLNRLAAHPPFASW 66 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 87 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 76 GVTQLNRLAAHPPFASW 92 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 113 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 73 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 87 QLAKGGCAARRLSWVTP 103 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 55 GVTQLNRLAAHPPFASW 71 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 92 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 42 GVTQLNRLAAHPPFASW 58 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 79 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 41.9 bits (94), Expect = 7e-04 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 727 CWKGQSVRAXFAITPSWRKGDVLQGD*VG*RPGFSQSRRCKTTAS 593 CW+G+SVRA ++ KG PGFSQSRRCKTTAS Sbjct: 5 CWEGRSVRAS-SLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = -3 Query: 683 QLAKGGCAARRLSWVTP 633 QLAKGGCAARRLSWVTP Sbjct: 19 QLAKGGCAARRLSWVTP 35 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 198 GVTQLNRLAAHPPFASW 214 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 235 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 47 GVTQLNRLAAHPPFASW 63 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 84 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 41.9 bits (94), Expect = 7e-04 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +1 Query: 634 GVTQLNRLAAHPPFASW 684 GVTQLNRLAAHPPFASW Sbjct: 53 GVTQLNRLAAHPPFASW 69 Score = 38.3 bits (85), Expect = 0.009 Identities = 26/55 (47%), Positives = 30/55 (54%) Frame = +3 Query: 594 LAVVLQRRDWENPGRYPT*SPCSTSPFRQLGVIAXKARTDCPFQHFXQLELANGK 758 LAVVLQRRDWENPG + PF + +ARTD P Q QL NG+ Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWR-NSEEARTDRPSQ---QLRSLNGE 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,804,397 Number of Sequences: 59808 Number of extensions: 633206 Number of successful extensions: 9007 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5480 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8637 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2848211039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -