BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30323.Seq (967 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 3.1 AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. 23 5.5 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 7.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 7.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 7.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 7.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 9.6 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = -2 Query: 459 DGFLSSTDDVGSFRGSW 409 DG SS D GS GSW Sbjct: 1064 DGITSSGSDSGSSNGSW 1080 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.4 bits (48), Expect = 3.1 Identities = 9/52 (17%), Positives = 19/52 (36%) Frame = -1 Query: 208 HATCLSMVYFVWHTLLNCTIASDVYNVSNFVHFHVRGERNSSMCAEPASEQV 53 H L V + CT+ + + + H++ +SS+ P + Sbjct: 245 HVLKLHQVAHYGEKVYKCTLCHETFGSKKTMELHIKTHSDSSVVGSPRDSPI 296 >AY898652-1|AAX83121.1| 349|Apis mellifera AKH receptor protein. Length = 349 Score = 22.6 bits (46), Expect = 5.5 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -1 Query: 697 FAITPSWRKGDVL 659 +AIT SW+ GDV+ Sbjct: 98 WAITVSWKAGDVM 110 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 7.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 136 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 234 R Q+ + + Y WK+RSR + + SR Sbjct: 45 REQKSYKNENSYRKYRETWKERSRDRTERERSR 77 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 7.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 136 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 234 R Q+ + + Y WK+RSR + + SR Sbjct: 45 REQKSYKNENSYRKYRETWKERSRDRTERERSR 77 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 7.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 136 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 234 R Q+ + + Y WK+RSR + + SR Sbjct: 45 REQKSYKNENSYRKYRETWKERSRDRTERERSR 77 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 7.2 Identities = 10/33 (30%), Positives = 16/33 (48%) Frame = +1 Query: 136 RHQRQWCSSKGYATQSIPWKDRSRVQRDCSCSR 234 R Q+ + + Y WK+RSR + + SR Sbjct: 45 REQKSYKNENSYRKYRETWKERSRDRTERERSR 77 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.8 bits (44), Expect = 9.6 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -2 Query: 621 SHDVVKRRPVNCNTTHYRANWVPGP 547 S + K++P +C+T YR V P Sbjct: 560 SDECNKKQPSDCDTLEYRNGEVTTP 584 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 265,033 Number of Sequences: 438 Number of extensions: 5512 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 31806957 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -