BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30319.Seq (835 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizo... 27 4.3 SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23... 26 5.7 >SPBP8B7.07c |set6||histone lysine methyltransferase Set6 |Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 26.6 bits (56), Expect = 4.3 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -1 Query: 832 NRQRRLQEPSLQXFHPQNRFCSTLEN 755 +R +RLQ+ +++ HP FCS +EN Sbjct: 420 DRAQRLQQ-AVRISHPSTTFCSNVEN 444 >SPBC646.13 |sds23|psp1, moc1|inducer of sexual development Sds23/Moc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 408 Score = 26.2 bits (55), Expect = 5.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -2 Query: 801 FSXFTLRTGFVQLSKIVLELCPQLWGLRXPSC 706 F+ + T L+K+V C +LW ++ PSC Sbjct: 299 FNIYESSTFAFTLAKLVATQCHRLWLVQSPSC 330 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,672,743 Number of Sequences: 5004 Number of extensions: 44560 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 410448950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -