BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30319.Seq (835 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein ... 29 0.17 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 29 0.23 DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific do... 24 5.0 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 24 5.0 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 24 5.0 >CR954256-5|CAJ14146.1| 615|Anopheles gambiae predicted protein protein. Length = 615 Score = 29.1 bits (62), Expect = 0.17 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = +3 Query: 216 AGEGAQKEDQRSRKENKGKPEPKPAKGVTVPTRK-GIKETQNVKSXXIKSGEQQKGKG 386 A EGA K ++ ++G+P PKP + +T T++ +K + V + ++ QQ G G Sbjct: 130 AAEGAPKPQRKL--SDRGEPPPKPDRRITTTTQQIVVKLPETVANVSLE--HQQSGAG 183 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 28.7 bits (61), Expect = 0.23 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -3 Query: 410 IXIDRSCRSLTLLLFSTFDVXRLHILSFLNALPGGNGYAFSGL 282 + + C + ++LFST+D L+ +LN + G NG S + Sbjct: 4 VITSKVCALIFIILFSTYDSVVLYPEEYLNIILGPNGTGKSAI 46 >DQ137802-1|AAZ78363.1| 265|Anopheles gambiae female-specific doublesex protein protein. Length = 265 Score = 24.2 bits (50), Expect = 5.0 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +3 Query: 228 AQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQN 338 AQ +D++ R N+G+ P+P + +P +K+ ++ Sbjct: 89 AQTQDEQ-RALNEGEVPPEPVANIHIPKLSELKDLKH 124 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 24.2 bits (50), Expect = 5.0 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = +3 Query: 228 AQKEDQRSRKENKGKPEPKPAKGVTVPTRKGIKETQN 338 AQ +D++ R N+G+ P+P + +P +K+ ++ Sbjct: 89 AQTQDEQ-RALNEGEVPPEPVANIHIPKLSELKDLKH 124 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 24.2 bits (50), Expect = 5.0 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 347 RLHILSFLNALPGGNGYAFSGLGFR 273 RLH + F++ G GYAF F+ Sbjct: 775 RLHWVEFMSKFYEGLGYAFKPFSFK 799 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,037 Number of Sequences: 2352 Number of extensions: 11494 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88065063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -