BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30314.Seq (733 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 7.4 AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha ... 23 9.7 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 23.4 bits (48), Expect = 7.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -3 Query: 95 YVVKRRPVNCNTTHYRANWVPGPPARAEFG 6 Y + RR TT A+ P P R+ FG Sbjct: 663 YPIYRRTTPTTTTTTTASPAPAPAIRSRFG 692 >AY027891-1|AAK15783.1| 801|Anopheles gambiae collagen IV alpha 1 chain precursor protein. Length = 801 Score = 23.0 bits (47), Expect = 9.7 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 2/61 (3%) Frame = +3 Query: 414 KGRKTVYQGDGPLREPSP*SSF--LGSRCRKALXGTPXGSPRFRALRGXPGXCWRXRXGX 587 KG+K DG P P G R G P G+P R RG G C + G Sbjct: 225 KGQKGEPGNDGLEGLPGPQGEVGPRGFPGRPGEKGVP-GTPGVRGERGDKGVCIKGEKGQ 283 Query: 588 K 590 K Sbjct: 284 K 284 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 717,743 Number of Sequences: 2352 Number of extensions: 14848 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -