BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30314.Seq (733 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. 33 1.4 U66146-1|AAC51165.1| 592|Homo sapiens CD6e protein. 30 7.4 L78838-2|AAL40085.1| 592|Homo sapiens T cell surface glycoprote... 30 7.4 >AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. Length = 1857 Score = 32.7 bits (71), Expect = 1.4 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Frame = +3 Query: 60 RITIHWP-SFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPN--SCAXEWRMA 230 R+ WP S +TGK A +L+ + +P G K P P+A PN + W M+ Sbjct: 1749 RVRGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPNRPDTSFSWFMS 1808 Query: 231 NCKR*YFV 254 K Y++ Sbjct: 1809 PFKCLYYL 1816 >U66146-1|AAC51165.1| 592|Homo sapiens CD6e protein. Length = 592 Score = 30.3 bits (65), Expect = 7.4 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 96 VTGKTLALPNLIALQHIPLS-PAGVIAKRPAPIALPNSCAXEWRMAN 233 + GK ALP ++ QH+P + PAG + +P PI +P + R+ + Sbjct: 426 IKGK-YALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEDSQRHRVTD 471 >L78838-2|AAL40085.1| 592|Homo sapiens T cell surface glycoprotein CD6 isoform e protein. Length = 592 Score = 30.3 bits (65), Expect = 7.4 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = +3 Query: 96 VTGKTLALPNLIALQHIPLS-PAGVIAKRPAPIALPNSCAXEWRMAN 233 + GK ALP ++ QH+P + PAG + +P PI +P + R+ + Sbjct: 426 IKGK-YALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEDSQRHRVTD 471 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,296,509 Number of Sequences: 237096 Number of extensions: 2345343 Number of successful extensions: 10736 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10606 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10736 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8679165170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -