BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30313.Seq (799 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 26 0.47 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 7.6 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 25.8 bits (54), Expect = 0.47 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = +3 Query: 708 MLHNFEKGRVXVFQHSVXPNSFLRHF 785 +LH+F+ V + H SF++H+ Sbjct: 348 VLHSFQMKNVTIVDHHTASESFMKHY 373 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.8 bits (44), Expect = 7.6 Identities = 10/37 (27%), Positives = 18/37 (48%) Frame = -1 Query: 256 CL*GILPISAYWLKNELI*QKFNANFNKILTLTICHS 146 CL I+ ++W+K E + +LTL+ H+ Sbjct: 256 CLIVIMSWVSFWIKPEAAPARVTLGVTSLLTLSTQHA 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,774 Number of Sequences: 438 Number of extensions: 4472 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -