BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30312.Seq (546 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein. 30 1.8 AE014296-2094|AAF49960.1| 635|Drosophila melanogaster CG17152-P... 30 2.3 >X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein. Length = 1494 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -2 Query: 185 DGFSPFDVGVHVL**WTLVPNWNNTQPYLGLFF*FIRDFADFGLLVKK*ADLTK 24 DG P D G+ + + + N + Q +LGL F R DF L K D+ K Sbjct: 923 DGIMPNDKGIEAIKNFPIPNNVHTVQSFLGLCSYFRRFIKDFSRLAKPLHDILK 976 >AE014296-2094|AAF49960.1| 635|Drosophila melanogaster CG17152-PA protein. Length = 635 Score = 29.9 bits (64), Expect = 2.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 544 GAFTGLXPNERIILECIWKXKQIGVPRT 461 G T PN R +L+CIW ++ P T Sbjct: 263 GGHTHFAPNSRFVLDCIWPAVEVLYPYT 290 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,499,197 Number of Sequences: 53049 Number of extensions: 398184 Number of successful extensions: 748 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2069139900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -