BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30312.Seq (546 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 0.88 DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 21 6.2 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 24.2 bits (50), Expect = 0.88 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +3 Query: 345 KXRALGRWQV*RVTCA*PPHPPRLMRRYXARQ 440 K A+G WQ+ V C+ PP R+ R+ Sbjct: 378 KNPAMGHWQMSCVACSPPPRQTPPSRKESGRR 409 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 21.4 bits (43), Expect = 6.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 160 ESTFFNSGLLFQTGTTLNPI 101 E + SG L+ TT+NPI Sbjct: 307 EWLYILSGCLYYFSTTINPI 326 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,403 Number of Sequences: 438 Number of extensions: 2924 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -