BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30310.Seq (609 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_3278| Best HMM Match : ORC2 (HMM E-Value=0) 30 1.3 SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_22170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.8 SB_36880| Best HMM Match : DUF1337 (HMM E-Value=0.54) 27 9.0 >SB_3278| Best HMM Match : ORC2 (HMM E-Value=0) Length = 459 Score = 30.3 bits (65), Expect = 1.3 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 318 RRVCDAPRPARHTSHDSVTLI*CHNGSHLATLRF*KKKSADGNSG-GQEGGSKKKDENEN 494 RR+ P+P + S DS H H T + + DGN +EG S K DE+EN Sbjct: 46 RRLPPRPQPIKPASKDSDDDTGSHTSGHENT----EDDTDDGNDDDNKEGSSGKDDESEN 101 Query: 495 Q 497 + Sbjct: 102 E 102 >SB_41378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 28.7 bits (61), Expect = 3.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +2 Query: 122 FYYNHVYSMRPYGMLQI*RLRSSAPVFASVSFQAKWLTRLPVFSK 256 FYY+H+ S L++ + P+FA + + +++ +LP F K Sbjct: 103 FYYDHLMSRDGSKPLRVRSMVGLVPLFACLVLEDEFVQKLPGFKK 147 >SB_22170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 27.9 bits (59), Expect = 6.8 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 4/48 (8%) Frame = -1 Query: 474 FWSHPPALRCFHRPTFFSKTVVLRG----GYHCDIRSKSLNRVTYVLP 343 FW HP + PT ++T L G G D ++SL R + VLP Sbjct: 336 FWDHPWGALSINTPTLVTQTGFLDGISDSGLLTDTHTRSLFRDSAVLP 383 >SB_36880| Best HMM Match : DUF1337 (HMM E-Value=0.54) Length = 367 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = +3 Query: 423 KKKSADGNSGGQEGGSKKKD---ENENQLKRTKAVN 521 KKK D G E KKKD E E +L++ + N Sbjct: 86 KKKQGDAKESGDEEEGKKKDEPTEKEEELRKERQEN 121 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,701,447 Number of Sequences: 59808 Number of extensions: 367817 Number of successful extensions: 1448 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1346 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1446 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1487884875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -