BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30310.Seq (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 1.4 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.5 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 25 2.5 EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger pr... 24 3.3 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 23 7.7 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.4 bits (53), Expect = 1.4 Identities = 12/46 (26%), Positives = 17/46 (36%) Frame = -1 Query: 531 PPRNSRLLFSLTDFRFHPFFWSHPPALRCFHRPTFFSKTVVLRGGY 394 PP R + F P + + PTFF +T L G+ Sbjct: 10 PPTRKRYCINSASIEFMPAGSERKDVCKTGYEPTFFLRTFDLNNGF 55 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.5 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 165 YKYEDCGPPLQCLPRSAFKRNGLQDCQFFQKVRFATCAVPALVLNR 302 Y++ D LQ + +++ N L DC +Q++ F A+ ++ R Sbjct: 1991 YRFRDRSYLLQAMTHASYSPNRLTDC--YQRLEFLGDAILDYLITR 2034 Score = 23.4 bits (48), Expect = 5.8 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = -1 Query: 471 WSHPPALRCFHRPTFFSKTVVLRGGYHCD 385 W L C +RP F + + RGG D Sbjct: 1545 WLRLHDLYCLNRPFFPERYTIFRGGSQFD 1573 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 24.6 bits (51), Expect = 2.5 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = +3 Query: 363 DSVTLI*CHNGSHLATLRF*KKKSADG-NSGGQEGGSKKKDEN 488 D T I H+ L S G GG EGGS K+D++ Sbjct: 1692 DGTTTIIIHDSEDEKDLDIILSGSGGGVGGGGDEGGSDKEDDD 1734 >EU068741-1|ABU40241.1| 993|Anopheles gambiae anion exchanger protein. Length = 993 Score = 24.2 bits (50), Expect = 3.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 423 KKKSADGNSGGQEGGSKKKDENENQLKRT 509 K + G GG +GGS K N L++T Sbjct: 389 KLLTVGGGGGGGDGGSDGKKPPNNPLEKT 417 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 23.0 bits (47), Expect = 7.7 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = -2 Query: 230 AISLES*PRQTLERRTAIFIFVTYHRAAWSTHDCSKIQANGGG 102 A+ L R +E+ A ++ + YH + ++T ++ A+G G Sbjct: 186 AMELRDRHRMPIEQ-IATWVCIAYHESRFNTSAEGRLNADGSG 227 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 595,834 Number of Sequences: 2352 Number of extensions: 11498 Number of successful extensions: 20 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -