BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30310.Seq (609 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY060765-1|AAL28313.1| 108|Drosophila melanogaster GH22881p pro... 47 2e-05 AE014134-1175|AAN10602.2| 108|Drosophila melanogaster CG17377-P... 47 2e-05 AE014134-1174|AAN10601.1| 287|Drosophila melanogaster CG17377-P... 47 2e-05 AE014134-1173|AAF52442.3| 173|Drosophila melanogaster CG17377-P... 47 2e-05 X67704-2|CAA47942.1| 265|Drosophila melanogaster sperm protein ... 31 1.6 AY118617-1|AAM49986.1| 265|Drosophila melanogaster LP10995p pro... 31 1.6 AY060667-1|AAL28215.1| 334|Drosophila melanogaster GH09231p pro... 31 1.6 AE014297-4222|AAF56780.1| 265|Drosophila melanogaster CG18396-P... 31 1.6 AE014297-4221|AAF56779.1| 334|Drosophila melanogaster CG11719-P... 31 1.6 X67704-1|CAA47941.1| 334|Drosophila melanogaster sperm protein ... 29 3.8 X98401-1|CAA67051.1| 398|Drosophila melanogaster phosphotyrosyl... 29 5.0 AY060614-1|AAL28162.1| 398|Drosophila melanogaster GH04025p pro... 29 5.0 AY051503-1|AAK92927.1| 2028|Drosophila melanogaster GH15471p pro... 29 5.0 AF454347-1|AAL87864.1| 617|Drosophila melanogaster unconvention... 29 5.0 AE014297-2146|ABI31171.1| 2160|Drosophila melanogaster CG31045-P... 29 5.0 AE014297-2145|AAN13695.2| 2194|Drosophila melanogaster CG31045-P... 29 5.0 AE014297-2143|AAF55271.3| 2148|Drosophila melanogaster CG31045-P... 29 5.0 AE014134-597|AAF51115.1| 398|Drosophila melanogaster CG3289-PA ... 29 5.0 AY119029-1|AAM50889.1| 507|Drosophila melanogaster LP05465p pro... 29 6.6 AE014134-2443|AAF53364.2| 620|Drosophila melanogaster CG8942-PA... 29 6.6 >AY060765-1|AAL28313.1| 108|Drosophila melanogaster GH22881p protein. Length = 108 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +2 Query: 509 KSRELRGGIMYYSCHCXKRNGLQHXXRRTGCRG 607 +SRELR GIMY +C C KRNGLQ R+ C+G Sbjct: 14 RSRELRCGIMYTTCDCVKRNGLQDKCPRSACQG 46 >AE014134-1175|AAN10602.2| 108|Drosophila melanogaster CG17377-PB, isoform B protein. Length = 108 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +2 Query: 509 KSRELRGGIMYYSCHCXKRNGLQHXXRRTGCRG 607 +SRELR GIMY +C C KRNGLQ R+ C+G Sbjct: 14 RSRELRCGIMYTTCDCVKRNGLQDKCPRSACQG 46 >AE014134-1174|AAN10601.1| 287|Drosophila melanogaster CG17377-PC, isoform C protein. Length = 287 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +2 Query: 509 KSRELRGGIMYYSCHCXKRNGLQHXXRRTGCRG 607 +SRELR GIMY +C C KRNGLQ R+ C+G Sbjct: 14 RSRELRCGIMYTTCDCVKRNGLQDKCPRSACQG 46 >AE014134-1173|AAF52442.3| 173|Drosophila melanogaster CG17377-PA, isoform A protein. Length = 173 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/33 (60%), Positives = 24/33 (72%) Frame = +2 Query: 509 KSRELRGGIMYYSCHCXKRNGLQHXXRRTGCRG 607 +SRELR GIMY +C C KRNGLQ R+ C+G Sbjct: 14 RSRELRCGIMYTTCDCVKRNGLQDKCPRSACQG 46 >X67704-2|CAA47942.1| 265|Drosophila melanogaster sperm protein protein. Length = 265 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 135 MCTPCGPMVCYKYEDCGPPLQCLPR--SAFKRNGLQDC 242 MC+PCGP C + C P +C P+ +A + L C Sbjct: 1 MCSPCGP--CSPCDPCCGPFECSPKCYNAAQLEALPQC 36 >AY118617-1|AAM49986.1| 265|Drosophila melanogaster LP10995p protein. Length = 265 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 135 MCTPCGPMVCYKYEDCGPPLQCLPR--SAFKRNGLQDC 242 MC+PCGP C + C P +C P+ +A + L C Sbjct: 1 MCSPCGP--CSPCDPCCGPFECSPKCYNAAQLEALPQC 36 >AY060667-1|AAL28215.1| 334|Drosophila melanogaster GH09231p protein. Length = 334 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 135 MCTPCGPMVCYKYEDCGPPLQCLPR--SAFKRNGLQDC 242 MC+PCGP C + C P +C P+ +A + L C Sbjct: 1 MCSPCGP--CSPCDPCCGPFECSPKCYNAAQLEALPQC 36 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 138 CTPCGPMVCYKYEDCGPPLQCLP 206 C PC P Y+ +CGP C P Sbjct: 287 CGPCSPPCPYESPECGPCYPCAP 309 >AE014297-4222|AAF56780.1| 265|Drosophila melanogaster CG18396-PA protein. Length = 265 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 135 MCTPCGPMVCYKYEDCGPPLQCLPR--SAFKRNGLQDC 242 MC+PCGP C + C P +C P+ +A + L C Sbjct: 1 MCSPCGP--CSPCDPCCGPFECSPKCYNAAQLEALPQC 36 >AE014297-4221|AAF56779.1| 334|Drosophila melanogaster CG11719-PA protein. Length = 334 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = +3 Query: 135 MCTPCGPMVCYKYEDCGPPLQCLPR--SAFKRNGLQDC 242 MC+PCGP C + C P +C P+ +A + L C Sbjct: 1 MCSPCGP--CSPCDPCCGPFECSPKCYNAAQLEALPQC 36 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 138 CTPCGPMVCYKYEDCGPPLQCLP 206 C PC P Y+ +CGP C P Sbjct: 287 CGPCSPPCPYESPECGPCYPCAP 309 >X67704-1|CAA47941.1| 334|Drosophila melanogaster sperm protein protein. Length = 334 Score = 29.5 bits (63), Expect = 3.8 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 138 CTPCGPMVCYKYEDCGPPLQCLP 206 C PC P Y+ +CGP C P Sbjct: 287 CGPCSPPCPYESPECGPCYPCAP 309 >X98401-1|CAA67051.1| 398|Drosophila melanogaster phosphotyrosyl phosphatase activatorprotein. Length = 398 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 555 QWQL*YIIPPRNSRLLFSLTDFRFHPFFW 469 Q Q Y + P S+ ++SL DF+F PF W Sbjct: 183 QLQRTYNMEPAGSQGVWSLDDFQFVPFIW 211 >AY060614-1|AAL28162.1| 398|Drosophila melanogaster GH04025p protein. Length = 398 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 555 QWQL*YIIPPRNSRLLFSLTDFRFHPFFW 469 Q Q Y + P S+ ++SL DF+F PF W Sbjct: 183 QLQRTYNMEPAGSQGVWSLDDFQFVPFIW 211 >AY051503-1|AAK92927.1| 2028|Drosophila melanogaster GH15471p protein. Length = 2028 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 327 CDAPRPARHTSHD-SVTLI*CHNGSHLATLRF*KK-KSADGNSGGQEGGSK 473 C AP A D S+T C+ A+ RF ++ + +GN GG+EGG+K Sbjct: 318 CMAPSTATVEEIDHSITNGNCNTLRRSASKRFKRQSRHENGNGGGEEGGAK 368 >AF454347-1|AAL87864.1| 617|Drosophila melanogaster unconventional myosin protein. Length = 617 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 327 CDAPRPARHTSHD-SVTLI*CHNGSHLATLRF*KK-KSADGNSGGQEGGSK 473 C AP A D S+T C+ A+ RF ++ + +GN GG+EGG+K Sbjct: 438 CMAPSTATVEEIDHSITNGNCNTLRRSASKRFKRQSRHENGNGGGEEGGAK 488 >AE014297-2146|ABI31171.1| 2160|Drosophila melanogaster CG31045-PG, isoform G protein. Length = 2160 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 327 CDAPRPARHTSHD-SVTLI*CHNGSHLATLRF*KK-KSADGNSGGQEGGSK 473 C AP A D S+T C+ A+ RF ++ + +GN GG+EGG+K Sbjct: 438 CMAPSTATVEEIDHSITNGNCNTLRRSASKRFKRQSRHENGNGGGEEGGAK 488 >AE014297-2145|AAN13695.2| 2194|Drosophila melanogaster CG31045-PB, isoform B protein. Length = 2194 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 327 CDAPRPARHTSHD-SVTLI*CHNGSHLATLRF*KK-KSADGNSGGQEGGSK 473 C AP A D S+T C+ A+ RF ++ + +GN GG+EGG+K Sbjct: 438 CMAPSTATVEEIDHSITNGNCNTLRRSASKRFKRQSRHENGNGGGEEGGAK 488 >AE014297-2143|AAF55271.3| 2148|Drosophila melanogaster CG31045-PA, isoform A protein. Length = 2148 Score = 29.1 bits (62), Expect = 5.0 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%) Frame = +3 Query: 327 CDAPRPARHTSHD-SVTLI*CHNGSHLATLRF*KK-KSADGNSGGQEGGSK 473 C AP A D S+T C+ A+ RF ++ + +GN GG+EGG+K Sbjct: 438 CMAPSTATVEEIDHSITNGNCNTLRRSASKRFKRQSRHENGNGGGEEGGAK 488 >AE014134-597|AAF51115.1| 398|Drosophila melanogaster CG3289-PA protein. Length = 398 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -1 Query: 555 QWQL*YIIPPRNSRLLFSLTDFRFHPFFW 469 Q Q Y + P S+ ++SL DF+F PF W Sbjct: 183 QLQRTYNMEPAGSQGVWSLDDFQFVPFIW 211 >AY119029-1|AAM50889.1| 507|Drosophila melanogaster LP05465p protein. Length = 507 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 132 IMCTPCGPMVCYKYEDCGPPLQCLPRSAFKRNGLQD 239 I C P P VC K E C P C ++ +KR D Sbjct: 122 IDCHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSD 157 >AE014134-2443|AAF53364.2| 620|Drosophila melanogaster CG8942-PA protein. Length = 620 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = +3 Query: 132 IMCTPCGPMVCYKYEDCGPPLQCLPRSAFKRNGLQD 239 I C P P VC K E C P C ++ +KR D Sbjct: 122 IDCHPVCPTVCGKNEFCDRPGVCSCQNGYKRTSPSD 157 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,752,947 Number of Sequences: 53049 Number of extensions: 535965 Number of successful extensions: 1344 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2503659279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -