BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30310.Seq (609 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53180-2|AAK68284.1| 477|Caenorhabditis elegans Hypothetical pr... 28 4.5 Z68337-9|CAA92751.2| 334|Caenorhabditis elegans Hypothetical pr... 28 6.0 Z81497-7|CAB04083.3| 652|Caenorhabditis elegans Hypothetical pr... 27 7.9 Z75955-17|CAB00127.3| 652|Caenorhabditis elegans Hypothetical p... 27 7.9 U80441-3|AAB37653.2| 262|Caenorhabditis elegans Hypothetical pr... 27 7.9 AL031632-7|CAA21009.2| 1528|Caenorhabditis elegans Hypothetical ... 27 7.9 >U53180-2|AAK68284.1| 477|Caenorhabditis elegans Hypothetical protein D1014.6 protein. Length = 477 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -1 Query: 477 FFWSHPPALRCFHRPTFFSK-TVVLRGGYHCDIRSKSLNRVTYVL 346 F W + C HR FFSK T V+ ++RS+S + +L Sbjct: 282 FMWHNAQINDCHHRSKFFSKWTAVIDIDERIEMRSESFKTIISLL 326 >Z68337-9|CAA92751.2| 334|Caenorhabditis elegans Hypothetical protein M7.13 protein. Length = 334 Score = 27.9 bits (59), Expect = 6.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 513 LLFSLTDFRFHPFFWSHPPAL 451 +L+S DF PFF+S+ PAL Sbjct: 58 ILYSFVDFVVAPFFYSYGPAL 78 >Z81497-7|CAB04083.3| 652|Caenorhabditis elegans Hypothetical protein R07B7.2 protein. Length = 652 Score = 27.5 bits (58), Expect = 7.9 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = -2 Query: 332 IAHTADRAVDTVED*SWHGTGSESNLLKKLAVL*AISLES*PRQTLERRTAIFIFV 165 I TA+R T + GT SES L++KLA L++ R+ ++ RTA I++ Sbjct: 96 ICSTANRTTQTCHATNIAGTNSESCLIEKLANSLLEHLQA--RRPIKARTAFPIYL 149 >Z75955-17|CAB00127.3| 652|Caenorhabditis elegans Hypothetical protein R07B7.2 protein. Length = 652 Score = 27.5 bits (58), Expect = 7.9 Identities = 20/56 (35%), Positives = 31/56 (55%) Frame = -2 Query: 332 IAHTADRAVDTVED*SWHGTGSESNLLKKLAVL*AISLES*PRQTLERRTAIFIFV 165 I TA+R T + GT SES L++KLA L++ R+ ++ RTA I++ Sbjct: 96 ICSTANRTTQTCHATNIAGTNSESCLIEKLANSLLEHLQA--RRPIKARTAFPIYL 149 >U80441-3|AAB37653.2| 262|Caenorhabditis elegans Hypothetical protein F27C1.3 protein. Length = 262 Score = 27.5 bits (58), Expect = 7.9 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +3 Query: 423 KKKSAD--GNSGGQEGGSKKKDENENQLKRTKAVN 521 KKK +D G +GG GG D+ +++ +R K N Sbjct: 40 KKKYSDETGTTGGTTGGDDDDDDEDDEKRRKKKKN 74 >AL031632-7|CAA21009.2| 1528|Caenorhabditis elegans Hypothetical protein Y32B12B.4 protein. Length = 1528 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 382 NVTMVATSQHYGFRKKSRPMETAEGRRVAPKKRMKTKI 495 NV +VA S +RK+ + T + + VAPKKR + + Sbjct: 1285 NVPVVAQSARRAYRKRIKT--TTDAKTVAPKKRSSSSM 1320 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,153,495 Number of Sequences: 27780 Number of extensions: 271627 Number of successful extensions: 682 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -