BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30308.Seq (812 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) 29 3.4 SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) 29 4.5 >SB_37980| Best HMM Match : 7tm_2 (HMM E-Value=5.3e-13) Length = 1297 Score = 29.5 bits (63), Expect = 3.4 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = -1 Query: 533 IWHAFKEYYVADIFLVAVK-KPWVRCPPSGKSNPIILP 423 I H + Y+ DIF V K +P+V C P K NP ILP Sbjct: 411 IVHWNNDNYI-DIFCVGHKIRPFVNCGPLYKRNPGILP 447 >SB_55131| Best HMM Match : fn3 (HMM E-Value=0.0083) Length = 1266 Score = 29.1 bits (62), Expect = 4.5 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -1 Query: 461 CPPSGKSNPIILPWGSTMPV*TAKFAGEPEYGCTLTPHSSD 339 C PSG++ P +PW ++ AK G ++ C T +D Sbjct: 939 CCPSGETTPSAVPWTNSYRRGAAKQWGTRKFSCQTTESWTD 979 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,721,250 Number of Sequences: 59808 Number of extensions: 517551 Number of successful extensions: 1051 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 991 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2263654701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -