BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30303.Seq (888 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.8 >SB_2847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 417 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -1 Query: 543 YKLISCTADSQGTRDTFAPASDDFQHADHQ*IKSSY*RLPSAHHFG 406 + + T D T FAP + DF+ H + +++ P+ H FG Sbjct: 50 HDFVPTTHDFAPTTHDFAPTTHDFRPTTHDFVPTAHDFAPTTHDFG 95 >SB_17996| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 778 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 236 RSRRSTSN-VDLLRASATQSKQRQEYGNHEPDASVD 132 R +++T N DLL+ + T+S+ +E EPDA D Sbjct: 38 RKKKATINPFDLLKENGTESEDDEESSTKEPDAVHD 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,454,335 Number of Sequences: 59808 Number of extensions: 543209 Number of successful extensions: 1885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1884 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2538363813 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -