BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30303.Seq (888 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 27 0.76 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.8 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 24 7.1 DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domai... 23 9.4 AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding pr... 23 9.4 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 27.1 bits (57), Expect = 0.76 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 597 CWLTWSPVSAARGTSTLPATRTAL 668 CWL ++ + RGT LPA TAL Sbjct: 501 CWLPFNFLMVRRGTVPLPARITAL 524 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 25.8 bits (54), Expect = 1.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +1 Query: 529 RNKFVGDGQSHHTRDHSTSGDVTAGLLGVLSRLHEARVHYL 651 R +F G G SHH + +T D GL+ +R AR+ Y+ Sbjct: 521 RKRFAGGGHSHHRSNDTT--DALCGLIFCNNRA-MARILYV 558 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.8 bits (49), Expect = 7.1 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 603 LTWSPVSAARGTSTLP 650 L WSP +A R S+LP Sbjct: 161 LGWSPAAAVRSDSSLP 176 >DQ370036-1|ABD18597.1| 103|Anopheles gambiae putative TIL domain protein protein. Length = 103 Score = 23.4 bits (48), Expect = 9.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 144 VRLVVTVLLSLFGLSSACTKKVYIACRSPAPC 239 +R V+TVLL LF L K + S PC Sbjct: 1 MRYVITVLLLLFTLCPFALAKRSFSLLSSDPC 32 >AY146723-1|AAO12083.1| 155|Anopheles gambiae odorant-binding protein AgamOBP17 protein. Length = 155 Score = 23.4 bits (48), Expect = 9.4 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = +2 Query: 452 YW*SACWKSSDAGANVS 502 +W CWK SD N++ Sbjct: 127 FWLHKCWKQSDPKVNMA 143 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 887,316 Number of Sequences: 2352 Number of extensions: 18146 Number of successful extensions: 47 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 95507181 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -