BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30302.Seq (888 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g59210.2 68418.m07421 myosin heavy chain-related contains wea... 33 0.25 At5g59210.1 68418.m07420 myosin heavy chain-related contains wea... 33 0.25 At5g10290.1 68418.m01194 leucine-rich repeat family protein / pr... 30 1.8 At1g69390.1 68414.m07966 chloroplast division protein, putative ... 30 2.4 At4g21030.1 68417.m03042 Dof-type zinc finger domain-containing ... 28 7.2 At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A... 28 7.2 At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A... 28 7.2 At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transfera... 28 9.5 >At5g59210.2 68418.m07421 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 433 Score = 33.1 bits (72), Expect = 0.25 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 82 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRN 252 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 285 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 344 Query: 253 TWSTATSCG 279 + + S G Sbjct: 345 EQAGSFSRG 353 >At5g59210.1 68418.m07420 myosin heavy chain-related contains weak similarity to Myosin heavy chain, gizzard smooth muscle (Swiss-Prot:P10587) [Gallus gallus] Length = 434 Score = 33.1 bits (72), Expect = 0.25 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 3/69 (4%) Frame = +1 Query: 82 ELSADTSNQDLE-EKLY--NSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRN 252 +L + NQ E EKL+ NS L+ Y ++ S ++E+Q K + QNV ++DK R Sbjct: 286 KLLMEIDNQSSEIEKLFEENSNLSASYQESINISNQWENQVKECLKQNVELREVLDKLRT 345 Query: 253 TWSTATSCG 279 + + S G Sbjct: 346 EQAGSFSRG 354 >At5g10290.1 68418.m01194 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 613 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLIIDKRRNTWSTATSCGSATDRKL 300 K+Y +L + AV++ ++ES G + Q V + + RN C + T+R L Sbjct: 303 KVYKGVLPDNTKVAVKRLTDFESPGGDAAFQREVEMISVAVHRNLLRLIGFCTTQTERLL 362 Query: 301 L 303 + Sbjct: 363 V 363 >At1g69390.1 68414.m07966 chloroplast division protein, putative (MinE1) identical to chloroplast division protein homolog MinE1 GI:17511220 from [Arabidopsis thaliana] Length = 229 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 55 MLAASAGVVELSADTSNQDLEEKLYNSILTGDYD 156 +LA + G ELS + Q++E LYN+I G +D Sbjct: 70 VLARNTGDYELSPSPAEQEIESFLYNAINMGFFD 103 >At4g21030.1 68417.m03042 Dof-type zinc finger domain-containing protein prolamin box binding factor, Zea mays, PID:g2393775 Length = 194 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 665 EQTSFSYLAGWKNHAP-WCCQRCCRRIQHG 579 +QT FSY K P + C+ CCR HG Sbjct: 29 DQTRFSYFNNNKKSQPRYKCKNCCRCWTHG 58 >At4g13310.2 68417.m02080 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 390 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 237 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g13310.1 68417.m02081 cytochrome P450 71A20, putative (CYP71A20) Identical to Cytochrome P450 (SP:Q9T0K2) [Arabidopsis thaliana]; similar to cytochrome P450 71A4, Solanum melongena, PIR2:S36805 Length = 497 Score = 28.3 bits (60), Expect = 7.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 121 KLYNSILTGDYDSAVRQSLEYESQGKGSIIQNVVNNLII 237 K+ + IL+G D A EY Q K IQN++NN ++ Sbjct: 103 KVVDKILSGGRDVAFAPYGEYWRQMKSICIQNLLNNKMV 141 >At4g15480.1 68417.m02366 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 490 Score = 27.9 bits (59), Expect = 9.5 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -1 Query: 297 FPVRCRPTACSSTPCVPSLVNDQVVNYI 214 FP P PCVP L ND++ +++ Sbjct: 174 FPTETEPELDVKLPCVPVLKNDEIPSFL 201 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,621,747 Number of Sequences: 28952 Number of extensions: 348078 Number of successful extensions: 821 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -