BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30299.Seq (835 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_801| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 3.5 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 29 4.6 SB_25693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 28 8.1 >SB_801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +2 Query: 260 DNADLYGEEVTKDYQRSYEVFARRVLGAAPMPFDKYTFMPSAMDFYQTSLRDPAFYQLYN 439 DN++ Y + + K Q YE FA+R L + D +PS Q +L Y LY+ Sbjct: 143 DNSEEYIDFLLKSEQSLYEDFAKRFLESGYFDCDLGKSVPSVHILRQDALSAIPIYALYH 202 Query: 440 R 442 + Sbjct: 203 Q 203 >SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 183 PFGGTERMSSHKCQG-ILLFHSFLRCASCSS 94 PF + SH C+G I H F RCA CS+ Sbjct: 221 PFCASAFTRSHHCRGHINSVHKFFRCAICSA 251 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +3 Query: 24 YSPIKTGYYPLMLTKFTPFAQRPDYYNLHTEENYERVRFL 143 Y P KT L K T A RP Y NL + Y R R+L Sbjct: 99 YVPWKTALNALSYLK-TVLANRPSYGNLQSCPKYNRFRYL 137 >SB_25693| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) Length = 826 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -2 Query: 186 GPFGGTERMSSHKCQGILLFHSFLRCASC 100 GP G +R S H+CQ +L+ + LRC C Sbjct: 788 GPTDG-QRPSQHQCQILLMDSAKLRCLCC 815 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,661,169 Number of Sequences: 59808 Number of extensions: 464760 Number of successful extensions: 1188 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1186 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2347493764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -