BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30298.Seq (830 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) 161 6e-40 SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) 32 0.50 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 31 0.87 SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.87 SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 31 1.5 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 30 2.0 SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.6 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 29 3.5 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 29 3.5 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 29 3.5 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 29 3.5 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 29 3.5 SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 29 3.5 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 29 3.5 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_55926| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 29 4.6 SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) 29 4.6 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) 29 6.1 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 29 6.1 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 29 6.1 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 29 6.1 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) 29 6.1 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 29 6.1 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 29 6.1 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 29 6.1 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 29 6.1 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) 29 6.1 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 29 6.1 SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) 29 6.1 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 29 6.1 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 29 6.1 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 29 6.1 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 29 6.1 SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 6.1 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 29 6.1 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 29 6.1 SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 29 6.1 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 29 6.1 SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.1 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 8.1 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 28 8.1 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 28 8.1 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) 28 8.1 SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 28 8.1 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 28 8.1 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 28 8.1 SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 28 8.1 SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 28 8.1 SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_58517| Best HMM Match : Ribosomal_L30_N (HMM E-Value=1.5e-32) Length = 245 Score = 161 bits (391), Expect = 6e-40 Identities = 82/133 (61%), Positives = 98/133 (73%) Frame = +1 Query: 283 KKREIFKRAEQYVKEYRIKERDXIRLXRQARNRGNYYVPGEAKLAFVIRIRGINQVSPKS 462 K++EIFKRAE+YVKEYR KE D +R+ + A+ GN+YVP EA+LAFVIRIRGIN VSPK Sbjct: 43 KRKEIFKRAEKYVKEYRQKEVDELRMKKMAKKHGNFYVPPEARLAFVIRIRGINGVSPKV 102 Query: 463 XXFXQXFRLXQIX*WLFVRLNKATVNMLRIAXXYIAWGYPNLKSVREXVYKRGFRQAEWT 642 Q RL QI +FVRLNKAT NMLRI YIA+GYPNLKSVRE +YKRG+ + + Sbjct: 103 RKILQLLRLRQINNGVFVRLNKATANMLRIVQPYIAFGYPNLKSVRELIYKRGYGKVDKQ 162 Query: 643 TYTNSLPNSIVEK 681 + NSIVEK Sbjct: 163 RVALT-DNSIVEK 174 >SB_14354| Best HMM Match : TEP1_N (HMM E-Value=4.1) Length = 275 Score = 32.3 bits (70), Expect = 0.50 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -1 Query: 65 HAARVSSYQKTCSPGDPLVLE 3 H+A V +CSPGDPLVLE Sbjct: 144 HSAAVGGGSNSCSPGDPLVLE 164 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.87 Identities = 11/24 (45%), Positives = 18/24 (75%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 +++H ++ S +CSPG+PLVLE Sbjct: 7 SRVHYRKIVSISNSCSPGEPLVLE 30 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 80 CEAKLHAARVSSYQKTCSPGDPLVLE 3 C K R + +CSPGDPLVLE Sbjct: 7 CAKKTETGRSACPSNSCSPGDPLVLE 32 >SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) Length = 428 Score = 31.5 bits (68), Expect = 0.87 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 80 CEAKLHAARVSSYQKTCSPGDPLVLE 3 CE ++ +CSPGDPLVLE Sbjct: 148 CECRMEGINCEVGSNSCSPGDPLVLE 173 >SB_17626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.5 bits (68), Expect = 0.87 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = -1 Query: 77 EAKLHAARVSSYQKTCSPGDPLVLE 3 EA L +R + +CSPGDPLVLE Sbjct: 32 EALLAYSRANKGSNSCSPGDPLVLE 56 >SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 31.5 bits (68), Expect = 0.87 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A +S +CSPGDPLVLE Sbjct: 8 LISANISQTSNSCSPGDPLVLE 29 >SB_9061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = +1 Query: 1 RSRTSGSPGLQVF**LDTRAAWSFASQHDGCDYRKE 108 RSRTSGSPGLQ F D R ++ SQH + +K+ Sbjct: 11 RSRTSGSPGLQEF---DLRHVFNAWSQHIKDEVQKQ 43 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +1 Query: 1 RSRTSGSPGLQVF**LDTRAAWSFASQHDG 90 RSRTSGSPGLQ F ++ + S H+G Sbjct: 665 RSRTSGSPGLQEFDVINQKRLISLQDVHEG 694 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/18 (72%), Positives = 14/18 (77%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 RVS +CSPGDPLVLE Sbjct: 30 RVSLISNSCSPGDPLVLE 47 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 RV++ +CSPGDPLVLE Sbjct: 19 RVNAVSNSCSPGDPLVLE 36 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 A + V+S +CSPGDPLVLE Sbjct: 13 AAVERPSVASQSNSCSPGDPLVLE 36 >SB_25292| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/26 (61%), Positives = 16/26 (61%) Frame = +2 Query: 2 ALELVDPPGCRFFDNLTHVPRGVLPR 79 ALELVDPPGCR L P VL R Sbjct: 12 ALELVDPPGCRNSIVLGVAPNWVLAR 37 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/25 (60%), Positives = 19/25 (76%) Frame = -1 Query: 77 EAKLHAARVSSYQKTCSPGDPLVLE 3 +A ++ ARV S +CSPGDPLVLE Sbjct: 3466 KALIYVARVVS--NSCSPGDPLVLE 3488 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 +V S +CSPGDPLVLE Sbjct: 43 KVQSLSNSCSPGDPLVLE 60 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = +2 Query: 2 ALELVDPPGCRFFDNLTHVPR 64 ALELVDPPGCR N+ V R Sbjct: 49 ALELVDPPGCRNSINIESVNR 69 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 R+++ +CSPGDPLVLE Sbjct: 6 RITAVSNSCSPGDPLVLE 23 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 2 ALELVDPPGCR-FFDNLTHVPRGVLPRSTMV 91 ALELVDPPGCR + H P +++ Sbjct: 99 ALELVDPPGCRNSIQQMVHTAMSAFPGKSII 129 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 2 ALELVDPPGCRFFDNLTHVPRGVLPRSTM 88 ALELVDPPGCR + V + V+P + M Sbjct: 75 ALELVDPPGCRNSMDSRVVGKPVVPAALM 103 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = -1 Query: 65 HAARVSSYQKTCSPGDPLVLE 3 H+ +S +CSPGDPLVLE Sbjct: 551 HSKILSDRSNSCSPGDPLVLE 571 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +2 Query: 2 ALELVDPPGCRFFDNLTHVPRGVLPRST 85 ALELVDPPGCR +++T P + P +T Sbjct: 99 ALELVDPPGCR--NSITGGPVSMEPLTT 124 >SB_3216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = -3 Query: 87 IVLRGKTPRGTCVKLSKNLQPGGSTSSRA 1 + L +T G L + LQPGGSTSSRA Sbjct: 2 LFLDARTQTGQSATLIEFLQPGGSTSSRA 30 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 ++S +CSPGDPLVLE Sbjct: 32 IASLSNSCSPGDPLVLE 48 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 65 HAARVSSYQKTCSPGDPLVLE 3 H + S +CSPGDPLVLE Sbjct: 35 HLSHKRSSSNSCSPGDPLVLE 55 >SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANIGKTSNSCSPGDPLVLE 29 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 SS +CSPGDPLVLE Sbjct: 57 SSISNSCSPGDPLVLE 72 >SB_21491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 52 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/18 (77%), Positives = 14/18 (77%), Gaps = 2/18 (11%) Frame = +2 Query: 2 ALELVDPPGCR--FFDNL 49 ALELVDPPGCR FD L Sbjct: 12 ALELVDPPGCRNSMFDTL 29 >SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + + +CSPGDPLVLE Sbjct: 8 LISANIKAGSNSCSPGDPLVLE 29 >SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = -1 Query: 71 KLHAARVSSYQKTCSPGDPLVLE 3 +LH+ + S+ +CSPGDPLVLE Sbjct: 8 RLHSGKASN---SCSPGDPLVLE 27 >SB_52165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/26 (53%), Positives = 18/26 (69%), Gaps = 3/26 (11%) Frame = -1 Query: 71 KLHAARVS---SYQKTCSPGDPLVLE 3 +LH+ + S S +CSPGDPLVLE Sbjct: 8 RLHSGKASGLHSGSNSCSPGDPLVLE 33 >SB_50071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 57 TCVKLSKNLQPGGSTSSRA 1 TC+ + LQPGGSTSSRA Sbjct: 99 TCLSCIEFLQPGGSTSSRA 117 >SB_31086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 AK+ + +CSPGDPLVLE Sbjct: 15 AKIKLFNIGHRSNSCSPGDPLVLE 38 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 VS +CSPGDPLVLE Sbjct: 14 VSKVSNSCSPGDPLVLE 30 >SB_16924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + + +CSPGDPLVLE Sbjct: 8 LISANIRNTSNSCSPGDPLVLE 29 >SB_14396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/24 (62%), Positives = 18/24 (75%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 A + +RVSS +CSPGDPLVLE Sbjct: 11 ANIVLSRVSS--NSCSPGDPLVLE 32 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 ++S +CSPGDPLVLE Sbjct: 7 INSVSNSCSPGDPLVLE 23 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = -1 Query: 77 EAKLHAARVSSY-QKTCSPGDPLVLE 3 EA + A + Y +CSPGDPLVLE Sbjct: 22 EADIEAKQRMEYLSNSCSPGDPLVLE 47 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 RV +CSPGDPLVLE Sbjct: 377 RVDRRSNSCSPGDPLVLE 394 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 SS +CSPGDPLVLE Sbjct: 17 SSTSNSCSPGDPLVLE 32 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 65 HAARVSSYQKTCSPGDPLVLE 3 H S +CSPGDPLVLE Sbjct: 3 HIKDAESTSNSCSPGDPLVLE 23 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 SS +CSPGDPLVLE Sbjct: 201 SSSSNSCSPGDPLVLE 216 >SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 8 ISELSNSCSPGDPLVLE 24 >SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) Length = 129 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 V+S +CSPGDPLVLE Sbjct: 2 VTSPSNSCSPGDPLVLE 18 >SB_58854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = -3 Query: 69 TPRGTCVKLSKNLQPGGSTSSRA 1 TP+ K + LQPGGSTSSRA Sbjct: 91 TPQNQHTKTIEFLQPGGSTSSRA 113 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 +R+ +CSPGDPLVLE Sbjct: 147 SRLEKISNSCSPGDPLVLE 165 >SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 ++S +CSPGDPLVLE Sbjct: 35 ITSTSNSCSPGDPLVLE 51 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 80 CEAKLHAARVSSYQKTCSPGDPLVLE 3 CE +L +CSPGDPLVLE Sbjct: 8 CENQLFVQGNCMKSNSCSPGDPLVLE 33 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 A+ S +CSPGDPLVLE Sbjct: 2 AKNSQLSNSCSPGDPLVLE 20 >SB_43538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANIPKRSNSCSPGDPLVLE 29 >SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) Length = 129 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 SS +CSPGDPLVLE Sbjct: 3 SSTSNSCSPGDPLVLE 18 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 ++++ +CSPGDPLVLE Sbjct: 20 KINNLSNSCSPGDPLVLE 37 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -1 Query: 80 CEAKLHAARVSSYQKTCSPGDPLVLE 3 C A R S +CSPGDPLVLE Sbjct: 7 CWAHNPEVRGSKPSNSCSPGDPLVLE 32 >SB_34552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 + A R +CSPGDPLVLE Sbjct: 23 IRATRRKPQSNSCSPGDPLVLE 44 >SB_30117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 77 EAKLHAARVSSYQKTCSPGDPLVLE 3 + +L A + +CSPGDPLVLE Sbjct: 17 QGELSAGTSAKESNSCSPGDPLVLE 41 >SB_7685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/29 (58%), Positives = 19/29 (65%), Gaps = 4/29 (13%) Frame = -3 Query: 75 GKTPRGTCVKLSKN----LQPGGSTSSRA 1 GK +G KLS+ LQPGGSTSSRA Sbjct: 7 GKLSQGNTGKLSQGNIEFLQPGGSTSSRA 35 >SB_5062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 AR+ +CSPGDPLVLE Sbjct: 9 ARLIRLSNSCSPGDPLVLE 27 >SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = -1 Query: 83 CCEAKLHAARVSSYQKTCSPGDPLVLE 3 C A + V +CSPGDPLVLE Sbjct: 33 CVRALRNDVLVIGISNSCSPGDPLVLE 59 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 +VS +CSPGDPLVLE Sbjct: 16 KVSITSNSCSPGDPLVLE 33 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 77 EAKLHAARVSSYQKTCSPGDPLVLE 3 EA++H +S +CSPGDPLVLE Sbjct: 69 EAEVHWGEGTS--NSCSPGDPLVLE 91 >SB_55926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/30 (60%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +1 Query: 1 RSRTSGSPGLQVF**LDTRAAW-SFASQHD 87 RSRTSGSPGLQ F D A + F+SQ D Sbjct: 11 RSRTSGSPGLQEF---DQGADYEDFSSQED 37 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 A L A + + +CSPGDPLVLE Sbjct: 20 AVLGAPELLTASNSCSPGDPLVLE 43 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S+ +CSPGDPLVLE Sbjct: 3 LSTQSNSCSPGDPLVLE 19 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 62 AARVSSYQKTCSPGDPLVLE 3 A + S +CSPGDPLVLE Sbjct: 18 AGSLRSRSNSCSPGDPLVLE 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 62 AARVSSYQKTCSPGDPLVLE 3 A+ V +CSPGDPLVLE Sbjct: 10 ASIVQQISNSCSPGDPLVLE 29 >SB_43938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +2 Query: 2 ALELVDPPGCR-FFDNLTHV 58 ALELVDPPGCR + + H+ Sbjct: 12 ALELVDPPGCRNSINTINHI 31 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 65 HAARVSSYQKTCSPGDPLVLE 3 HA + +CSPGDPLVLE Sbjct: 17 HAKNDALSSNSCSPGDPLVLE 37 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISKTSNSCSPGDPLVLE 47 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/16 (81%), Positives = 14/16 (87%), Gaps = 1/16 (6%) Frame = -1 Query: 47 SYQK-TCSPGDPLVLE 3 SYQ +CSPGDPLVLE Sbjct: 9 SYQSNSCSPGDPLVLE 24 >SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANIKFRSNSCSPGDPLVLE 29 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANIVHISNSCSPGDPLVLE 29 >SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 2/27 (7%) Frame = -1 Query: 77 EAKLHAARVSSYQ--KTCSPGDPLVLE 3 E K+H SS + +CSPGDPLVLE Sbjct: 39 EDKIHKIVKSSSRASNSCSPGDPLVLE 65 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 SS +CSPGDPLVLE Sbjct: 109 SSPSNSCSPGDPLVLE 124 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 A+ A ++ +CSPGDPLVLE Sbjct: 36 ARKRARAEAALSNSCSPGDPLVLE 59 >SB_38949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = -1 Query: 65 HAARVSSYQKTCSPGDPLVLE 3 H R + +CSPGDPLVLE Sbjct: 9 HLGRHLTGSNSCSPGDPLVLE 29 >SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) Length = 134 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 7 ISKTSNSCSPGDPLVLE 23 >SB_17005| Best HMM Match : DUF765 (HMM E-Value=7.4) Length = 138 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 +R + +CSPGDPLVLE Sbjct: 9 SRATKTSNSCSPGDPLVLE 27 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Frame = -1 Query: 83 CCEAKLHAARVSSYQ----KTCSPGDPLVLE 3 C E K +A R + + +CSPGDPLVLE Sbjct: 37 CLEQKQNAIRACTDKPFRSNSCSPGDPLVLE 67 >SB_14019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + + +CSPGDPLVLE Sbjct: 8 LISANILAGSNSCSPGDPLVLE 29 >SB_3843| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 265 RSSAIKKKREIFKRAEQYVKEYRIKERDXIRLXRQARNRGNY 390 R AI ++RE+++R E Y + + R+ R R R Y Sbjct: 16 RRRAINRRREMYRRREMYRRREMYRRREMYRRREMYRRREMY 57 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_55976| Best HMM Match : zf-C3HC4 (HMM E-Value=0.087) Length = 171 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANICFTSNSCSPGDPLVLE 29 >SB_51325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 +RV +CSPGDPLVLE Sbjct: 42 SRVVVTSNSCSPGDPLVLE 60 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_42884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_42082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_39315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 32 ALELVDPPGCR 42 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_30147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 88 ALELVDPPGCR 98 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 656 ALELVDPPGCR 666 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 77 EAKLHAARVSSYQKTCSPGDPLVLE 3 + + A+ + +CSPGDPLVLE Sbjct: 106 QRRFTASDTNEVSNSCSPGDPLVLE 130 >SB_18671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 +R + +CSPGDPLVLE Sbjct: 3 SRFQATSNSCSPGDPLVLE 21 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_15561| Best HMM Match : Protamine_P2 (HMM E-Value=8.8) Length = 182 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 V+ +CSPGDPLVLE Sbjct: 49 VNDISNSCSPGDPLVLE 65 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 29 ALELVDPPGCR 39 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 69 ALELVDPPGCR 79 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_8545| Best HMM Match : C2 (HMM E-Value=0.00073) Length = 106 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 71 KLHAARVSSYQKTCSPGDPLVLE 3 + H + +CSPGDPLVLE Sbjct: 25 RYHLFGIGVLSNSCSPGDPLVLE 47 >SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/20 (60%), Positives = 16/20 (80%), Gaps = 2/20 (10%) Frame = -1 Query: 56 RVSSYQKT--CSPGDPLVLE 3 R +Y+++ CSPGDPLVLE Sbjct: 2 RTDAYERSNSCSPGDPLVLE 21 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_967| Best HMM Match : Calx-beta (HMM E-Value=2.8) Length = 123 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) Length = 214 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 77 EAKLHAARVSSYQKTCSPGDPLVLE 3 +A H + +CSPGDPLVLE Sbjct: 177 DAAAHEVQDLCKSNSCSPGDPLVLE 201 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_56708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 67 ALELVDPPGCR 77 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -1 Query: 71 KLHAARVSSY-QKTCSPGDPLVLE 3 KL A++ + + +CSPGDPLVLE Sbjct: 37 KLKASKKNFFISNSCSPGDPLVLE 60 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 28.7 bits (61), Expect = 6.1 Identities = 14/27 (51%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = -1 Query: 80 CEAKLHAARVSSYQK-TCSPGDPLVLE 3 C + + A VS + +CSPGDPLVLE Sbjct: 104 CVSDVTRALVSKAESNSCSPGDPLVLE 130 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 29 ALELVDPPGCR 39 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 16 ASISNSCSPGDPLVLE 31 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_40500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_39375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 AR +CSPGDPLVLE Sbjct: 22 ARTCFSSNSCSPGDPLVLE 40 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_39260| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 175 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 + AA ++ +CSPGDPLVLE Sbjct: 43 VEAAGGTASSNSCSPGDPLVLE 64 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 V++ +CSPGDPLVLE Sbjct: 147 VANSSNSCSPGDPLVLE 163 >SB_33266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = -3 Query: 60 GTCVKLSKNLQPGGSTSSRA 1 G V++ + LQPGGSTSSRA Sbjct: 19 GVYVEIIEFLQPGGSTSSRA 38 >SB_32855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANILHASNSCSPGDPLVLE 29 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 VS +CSPGDPLVLE Sbjct: 4 VSLSSNSCSPGDPLVLE 20 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 VS +CSPGDPLVLE Sbjct: 10 VSYTSNSCSPGDPLVLE 26 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 32 ISLISNSCSPGDPLVLE 48 >SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 V++ +CSPGDPLVLE Sbjct: 12 VTASSNSCSPGDPLVLE 28 >SB_13893| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 28.7 bits (61), Expect = 6.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 265 RSSAIKKKREIFKRAEQYVKEYRIKERDXIRLXRQARNRGNY 390 R + ++REI++R E Y + + R+ RL R R Y Sbjct: 27 RRREMYRRREIYRRREMYRRREMYRRREMYRLREMYRRREMY 68 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 88 ALELVDPPGCR 98 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 31 ISLISNSCSPGDPLVLE 47 >SB_5183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +2 Query: 2 ALELVDPPGCR 34 ALELVDPPGCR Sbjct: 12 ALELVDPPGCR 22 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 29 ISLISNSCSPGDPLVLE 45 >SB_4378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 28.7 bits (61), Expect = 6.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 + S +CSPGDPLVLE Sbjct: 30 IHSASNSCSPGDPLVLE 46 >SB_719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 293 Score = 28.7 bits (61), Expect = 6.1 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -1 Query: 80 CEAKLHAARVSSYQKTCSPGDPLVLE 3 C A+ +CSPGDPLVLE Sbjct: 157 CAARTKPLTQEKGSNSCSPGDPLVLE 182 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 8.1 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 +++ +CSPGDPLVLE Sbjct: 6 ITTTSNSCSPGDPLVLE 22 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L R +CSPGDPLVLE Sbjct: 10 LRVQRFRIISNSCSPGDPLVLE 31 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A + +CSPGDPLVLE Sbjct: 8 LISANIFFRSNSCSPGDPLVLE 29 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 13 SQVSNSCSPGDPLVLE 28 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S+ +CSPGDPLVLE Sbjct: 12 STASNSCSPGDPLVLE 27 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 61 SQSNSCSPGDPLVLE 75 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 62 AARVSSYQKTCSPGDPLVLE 3 A+ S +CSPGDPLVLE Sbjct: 23 ASLCRSRSNSCSPGDPLVLE 42 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 62 AARVSSYQKTCSPGDPLVLE 3 A R +CSPGDPLVLE Sbjct: 77 AKRQQMASNSCSPGDPLVLE 96 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S+ +CSPGDPLVLE Sbjct: 64 STTSNSCSPGDPLVLE 79 >SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 RV +CSPGDPLVLE Sbjct: 4 RVIFTSNSCSPGDPLVLE 21 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = -1 Query: 74 AKLHAARVSSYQ----KTCSPGDPLVLE 3 AK+H + S + +CSPGDPLVLE Sbjct: 66 AKVHCRKQRSREVATSNSCSPGDPLVLE 93 >SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +A ++S +CSPGDPLVLE Sbjct: 8 LISANINS-SNSCSPGDPLVLE 28 >SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S+ +CSPGDPLVLE Sbjct: 3 SNRSNSCSPGDPLVLE 18 >SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 3 SLSNSCSPGDPLVLE 17 >SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 83 CCEAKLHAARVSSYQKTCSPGDPLVLE 3 C L ++ +CSPGDPLVLE Sbjct: 22 CSLILLIVPNATAQSNSCSPGDPLVLE 48 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 R+ +CSPGDPLVLE Sbjct: 5 RIYLISNSCSPGDPLVLE 22 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 2 SQISNSCSPGDPLVLE 17 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 11 SLSNSCSPGDPLVLE 25 >SB_52699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/22 (63%), Positives = 15/22 (68%) Frame = -3 Query: 66 PRGTCVKLSKNLQPGGSTSSRA 1 P G V + LQPGGSTSSRA Sbjct: 2 PYGLIVLTIEFLQPGGSTSSRA 23 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 31 SISNSCSPGDPLVLE 45 >SB_47825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/20 (65%), Positives = 15/20 (75%), Gaps = 3/20 (15%) Frame = -1 Query: 53 VSSYQKT---CSPGDPLVLE 3 + SY+ T CSPGDPLVLE Sbjct: 17 IGSYEVTSNSCSPGDPLVLE 36 >SB_47789| Best HMM Match : Ldl_recept_a (HMM E-Value=4.2e-34) Length = 262 Score = 28.3 bits (60), Expect = 8.1 Identities = 18/48 (37%), Positives = 24/48 (50%) Frame = -2 Query: 703 WLCLWKPSSQQCCXEVNWYTLSTQLGEIXVCILTHGHSLSWGIPKQCK 560 +LCL P+S QC N T++ G I +C +G L G QCK Sbjct: 139 FLCLPTPNSYQCACPDNMRTVNGMFGRI-ICRCQNGEVLVNG---QCK 182 >SB_47580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 4 ASSSNSCSPGDPLVLE 19 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 V + +CSPGDPLVLE Sbjct: 53 VRALSNSCSPGDPLVLE 69 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L A V +CSPGDPLVLE Sbjct: 58 LLALTVFMLSNSCSPGDPLVLE 79 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 22 SLSNSCSPGDPLVLE 36 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 4 SISNSCSPGDPLVLE 18 >SB_35710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -3 Query: 84 VLRGKTPRGTCVKLSKNLQPGGSTSSRA 1 +L+ KT V + LQPGGSTSSRA Sbjct: 2 LLKEKTKLNMIVFCIEFLQPGGSTSSRA 29 >SB_34253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 62 AARVSSYQKTCSPGDPLVLE 3 +A S +CSPGDPLVLE Sbjct: 8 SASFLSSSNSCSPGDPLVLE 27 >SB_33340| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 7 SLSNSCSPGDPLVLE 21 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 +S +CSPGDPLVLE Sbjct: 355 ASASNSCSPGDPLVLE 370 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 84 SLSNSCSPGDPLVLE 98 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 14 SVSNSCSPGDPLVLE 28 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -1 Query: 47 SYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 31 SISNSCSPGDPLVLE 45 >SB_30669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 28.3 bits (60), Expect = 8.1 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 ARV + +CSPGDPLVLE Sbjct: 7 ARVDA-SNSCSPGDPLVLE 24 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 R+ +CSPGDPLVLE Sbjct: 112 RLLGISNSCSPGDPLVLE 129 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -1 Query: 59 ARVSSYQKTCSPGDPLVLE 3 A S +CSPGDPLVLE Sbjct: 48 AENGSESNSCSPGDPLVLE 66 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -1 Query: 53 VSSYQKTCSPGDPLVLE 3 V + +CSPGDPLVLE Sbjct: 87 VMTISNSCSPGDPLVLE 103 >SB_17014| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 68 LHAARVSSYQKTCSPGDPLVLE 3 L +R +CSPGDPLVLE Sbjct: 7 LEGSRRLQTSNSCSPGDPLVLE 28 >SB_16113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = -1 Query: 74 AKLHAARVSSYQKTCSPGDPLVLE 3 A + + + +CSPGDPLVLE Sbjct: 11 ANIRLRGICAASNSCSPGDPLVLE 34 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S+ +CSPGDPLVLE Sbjct: 13 STASNSCSPGDPLVLE 28 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 28.3 bits (60), Expect = 8.1 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -1 Query: 50 SSYQKTCSPGDPLVLE 3 S +CSPGDPLVLE Sbjct: 4 SKISNSCSPGDPLVLE 19 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 28.3 bits (60), Expect = 8.1 Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Frame = -3 Query: 90 TIVLRGKTPRGTCVKLS-KNLQPGGSTSSRA 1 TI R + R T +S + LQPGGSTSSRA Sbjct: 51 TIETRRRKNRRTSAGISIEFLQPGGSTSSRA 81 >SB_7555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.3 bits (60), Expect = 8.1 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -1 Query: 56 RVSSYQKTCSPGDPLVLE 3 RV +CSPGDPLVLE Sbjct: 47 RVYVTSNSCSPGDPLVLE 64 >SB_5918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/28 (53%), Positives = 18/28 (64%) Frame = -3 Query: 84 VLRGKTPRGTCVKLSKNLQPGGSTSSRA 1 + R P T +L + LQPGGSTSSRA Sbjct: 12 IQRDYCPFLTGTRLIEFLQPGGSTSSRA 39 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 8.1 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -1 Query: 80 CEAKLHAARVSSYQKTCSPGDPLVLE 3 C K H +S+ +CSPGDPLVLE Sbjct: 17 CLNKCHNIVISN---SCSPGDPLVLE 39 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,141,269 Number of Sequences: 59808 Number of extensions: 377396 Number of successful extensions: 3018 Number of sequences better than 10.0: 205 Number of HSP's better than 10.0 without gapping: 2967 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3017 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2335516755 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -