BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30297.Seq (783 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003139-2|AAB54165.1| 244|Caenorhabditis elegans Ribosomal pro... 87 1e-17 U41106-1|AAA82409.1| 347|Caenorhabditis elegans Hypothetical pr... 33 0.30 AF067940-8|AAC19200.1| 518|Caenorhabditis elegans Hypothetical ... 29 5.0 >AF003139-2|AAB54165.1| 244|Caenorhabditis elegans Ribosomal protein, large subunitprotein 7 protein. Length = 244 Score = 87.0 bits (206), Expect = 1e-17 Identities = 41/86 (47%), Positives = 61/86 (70%) Frame = +3 Query: 246 QEEREIFKRAEQYVKEYRIKERDEIRLARQARNRGNYYVPGEAKLAFVIRIRGINQVSPK 425 +++ + FKRAE+YV+EYR +++ +RL R+A +G++YVP E K+AFV+RIRGINQ+ PK Sbjct: 41 EKKTQYFKRAEKYVQEYRNAQKEGLRLKREAEAKGDFYVPAEHKVAFVVRIRGINQLHPK 100 Query: 426 SVKFCNCLDCAK*TMVCFVRLNKATV 503 K L + FV+LNKAT+ Sbjct: 101 PRKALQILRLRQINNGVFVKLNKATL 126 Score = 73.7 bits (173), Expect = 1e-13 Identities = 33/62 (53%), Positives = 41/62 (66%) Frame = +2 Query: 428 RKVLQLFRLRQINNGVFCTSE*GYCEYLRIAEPYIAWGYPNLKSVREXVYKRGFAXLQPX 607 RK LQ+ RLRQINNGVF LRI EPY+AWGYPN K++ + +YKRG+A + Sbjct: 102 RKALQILRLRQINNGVFVKLNKATLPLLRIIEPYVAWGYPNNKTIHDLLYKRGYAKVDGN 161 Query: 608 NV 613 V Sbjct: 162 RV 163 >U41106-1|AAA82409.1| 347|Caenorhabditis elegans Hypothetical protein W06A11.4 protein. Length = 347 Score = 32.7 bits (71), Expect = 0.30 Identities = 22/71 (30%), Positives = 32/71 (45%) Frame = +1 Query: 247 KKKGKSSRGLNSTSRNTASRNVMKSD*PDKHAIVATTTFPGKPNWHLSSESVVSTKFHRS 426 KK+ K SR SR ASR +K K A +T P +PN + S S S ++ + Sbjct: 21 KKRRKMSRKFTKKSRKRASRASIKLANEQKAKKYANSTVPMEPNVYTDSGSPFSNRYASN 80 Query: 427 P*SSATV*TAP 459 S + + P Sbjct: 81 RSSQVKIRSVP 91 >AF067940-8|AAC19200.1| 518|Caenorhabditis elegans Hypothetical protein F36F12.1 protein. Length = 518 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 347 WQLLRSRGSQIGICHPNPWYQPSFTEV-RKVLQLFRLRQINN 469 +Q++R G Q+GI PW P F++V R L+ R ++ N Sbjct: 210 YQMVRELG-QLGIVTTQPWLTPKFSQVARPFLEPSRNSELRN 250 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,015,953 Number of Sequences: 27780 Number of extensions: 267987 Number of successful extensions: 611 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 611 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1893203640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -