BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30294.Seq (403 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF038619-6|AAB92077.2| 442|Caenorhabditis elegans Hypothetical ... 29 0.94 AL110501-1|CAB54509.1| 2129|Caenorhabditis elegans Hypothetical ... 27 6.7 AC006620-1|AAF39780.1| 754|Caenorhabditis elegans Hypothetical ... 27 6.7 U00052-10|AAK21429.2| 289|Caenorhabditis elegans Rnp (rrm rna b... 26 8.8 AL110501-2|CAE47474.1| 1271|Caenorhabditis elegans Hypothetical ... 26 8.8 AF125459-6|AAN60503.1| 219|Caenorhabditis elegans Hypothetical ... 26 8.8 AF125459-5|AAD12844.1| 345|Caenorhabditis elegans Hypothetical ... 26 8.8 >AF038619-6|AAB92077.2| 442|Caenorhabditis elegans Hypothetical protein F56A11.6 protein. Length = 442 Score = 29.5 bits (63), Expect = 0.94 Identities = 26/88 (29%), Positives = 35/88 (39%) Frame = +2 Query: 125 EKPKRSTKSNERRRSPREVLSFSKIWKXRXVXRXREXSRXAREGSAAVAPPRKPCGXXXX 304 EK + TK N RRR+ S + K R R R R+ S R P Sbjct: 237 EKFSKKTKLNFRRRTEDVDRSKDRSLKRRE-ERSRSRQDRERDRSRGGEKSRSPRKSHQK 295 Query: 305 XXXXXKHRLALERXKLRADREKIEREKN 388 K R +R + R DRE +RE++ Sbjct: 296 SVDRDKTRSDKDRSRSRKDREDRDRERS 323 >AL110501-1|CAB54509.1| 2129|Caenorhabditis elegans Hypothetical protein Y79H2A.3a protein. Length = 2129 Score = 26.6 bits (56), Expect = 6.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 113 RSDREKPKRSTKSNERRRSPREVLSFSK-IWKXRXVXRXREXSRXAREGSAAVAPPRK 283 RS K RS + RRRS S S+ ++ R R R SR A PP++ Sbjct: 1523 RSREHKRARSRSAERRRRSRTRSRSRSRERYRSRRDRRSRTKSRSRSRSREAAPPPQQ 1580 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 320 KHRLALERXKLRADREKIEREKNE 391 K +LA+++ KLR +E ++RE E Sbjct: 1068 KEKLAIDKEKLRLKKEALQRELEE 1091 >AC006620-1|AAF39780.1| 754|Caenorhabditis elegans Hypothetical protein C51G7.3 protein. Length = 754 Score = 26.6 bits (56), Expect = 6.7 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Frame = +2 Query: 113 RSDREKPKRSTKSNERRRSPREVLSFSK-IWKXRXVXRXREXSRXAREGSAAVAPPRK 283 RS K RS + RRRS S S+ ++ R R R SR A PP++ Sbjct: 148 RSREHKRARSRSAERRRRSRTRSRSRSRERYRSRRDRRSRTKSRSRSRSREAAPPPQQ 205 >U00052-10|AAK21429.2| 289|Caenorhabditis elegans Rnp (rrm rna binding domain) containingprotein 5 protein. Length = 289 Score = 26.2 bits (55), Expect = 8.8 Identities = 18/57 (31%), Positives = 26/57 (45%) Frame = +2 Query: 113 RSDREKPKRSTKSNERRRSPREVLSFSKIWKXRXVXRXREXSRXAREGSAAVAPPRK 283 R+DR++P R + S RRR P + + R R R + R +A A P K Sbjct: 78 RADRDRPMRPSPSPPRRRRPSPSPP-RRDRRDRSGSRQRRRASPRRSPAARSASPAK 133 >AL110501-2|CAE47474.1| 1271|Caenorhabditis elegans Hypothetical protein Y79H2A.3b protein. Length = 1271 Score = 26.2 bits (55), Expect = 8.8 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 320 KHRLALERXKLRADREKIEREKNE 391 K +LA+++ KLR +E ++RE E Sbjct: 1068 KEKLAIDKEKLRLKKEALQRELEE 1091 >AF125459-6|AAN60503.1| 219|Caenorhabditis elegans Hypothetical protein Y25C1A.8b protein. Length = 219 Score = 26.2 bits (55), Expect = 8.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 110 HRSDREKPKRSTKSNERRRSP 172 +R DR KRS +S ERRRSP Sbjct: 169 YRDDRRDRKRS-RSRERRRSP 188 >AF125459-5|AAD12844.1| 345|Caenorhabditis elegans Hypothetical protein Y25C1A.8a protein. Length = 345 Score = 26.2 bits (55), Expect = 8.8 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = +2 Query: 110 HRSDREKPKRSTKSNERRRSP 172 +R DR KRS +S ERRRSP Sbjct: 295 YRDDRRDRKRS-RSRERRRSP 314 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,348,349 Number of Sequences: 27780 Number of extensions: 45193 Number of successful extensions: 228 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 197 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 222 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 630384202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -