BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30291.Seq (698 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical pr... 31 0.60 Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical p... 28 7.4 Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical p... 28 7.4 AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical ... 28 7.4 Z68882-17|CAI79150.1| 111|Caenorhabditis elegans Hypothetical p... 27 9.8 U39667-7|AAP31442.1| 324|Caenorhabditis elegans Disorganized mu... 27 9.8 U39667-6|AAC69011.2| 640|Caenorhabditis elegans Disorganized mu... 27 9.8 AY095447-1|AAM23316.1| 640|Caenorhabditis elegans DIM-1(L) prot... 27 9.8 AF500489-1|AAM21705.1| 324|Caenorhabditis elegans DIM-1 short p... 27 9.8 >U41017-1|AAC48211.1| 343|Caenorhabditis elegans Hypothetical protein T26C11.2 protein. Length = 343 Score = 31.5 bits (68), Expect = 0.60 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 340 EPTPK-ESEPFKSVVPDNKPFGYPFDRPV 257 +PTPK +SEPF +P +KP PF P+ Sbjct: 7 KPTPKPKSEPFPKPMPKSKPKSEPFPSPM 35 >Z75714-11|CAB00063.2| 723|Caenorhabditis elegans Hypothetical protein ZC434.6b protein. Length = 723 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 211 WSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 83 W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 74 WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >Z75714-10|CAN99711.1| 721|Caenorhabditis elegans Hypothetical protein ZC434.6a protein. Length = 721 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = -2 Query: 211 WSTMKENYSPIYLTFLTIHQIKRNYNALIRKSKRTLTITVYNS 83 W++ YS Y L ++ I+R+ + ++ SK I +YNS Sbjct: 74 WNSFYPKYSGKYWALLPVNLIRRDTISQLKSSKCLSGIVLYNS 116 >AF024500-4|AAB70365.1| 335|Caenorhabditis elegans Hypothetical protein K06H6.6 protein. Length = 335 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -1 Query: 209 VYHEGELFPYLFNIPHYTPDK 147 VY G L PY + +PH+TP K Sbjct: 302 VYRNGGLNPYDYYLPHWTPLK 322 >Z68882-17|CAI79150.1| 111|Caenorhabditis elegans Hypothetical protein C47E12.14 protein. Length = 111 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -2 Query: 121 KSKRTLTITVYNSRISCEYVKTVANV 44 KSK TL ++ +R+S ++VKT NV Sbjct: 58 KSKFTLAQPIFKNRMSADFVKTHKNV 83 >U39667-7|AAP31442.1| 324|Caenorhabditis elegans Disorganized muscle protein 1,isoform b protein. Length = 324 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 595 QLSSRAEGEAVLXVFRSKEXLEGRR*WQ 678 Q+SSR +G+ ++ FR+K LE WQ Sbjct: 113 QISSRDDGQVMVMEFRAKSILEPTFVWQ 140 >U39667-6|AAC69011.2| 640|Caenorhabditis elegans Disorganized muscle protein 1,isoform a protein. Length = 640 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 595 QLSSRAEGEAVLXVFRSKEXLEGRR*WQ 678 Q+SSR +G+ ++ FR+K LE WQ Sbjct: 429 QISSRDDGQVMVMEFRAKSILEPTFVWQ 456 >AY095447-1|AAM23316.1| 640|Caenorhabditis elegans DIM-1(L) protein. Length = 640 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 595 QLSSRAEGEAVLXVFRSKEXLEGRR*WQ 678 Q+SSR +G+ ++ FR+K LE WQ Sbjct: 429 QISSRDDGQVMVMEFRAKSILEPTFVWQ 456 >AF500489-1|AAM21705.1| 324|Caenorhabditis elegans DIM-1 short protein isoform protein. Length = 324 Score = 27.5 bits (58), Expect = 9.8 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 595 QLSSRAEGEAVLXVFRSKEXLEGRR*WQ 678 Q+SSR +G+ ++ FR+K LE WQ Sbjct: 113 QISSRDDGQVMVMEFRAKSILEPTFVWQ 140 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,508,701 Number of Sequences: 27780 Number of extensions: 237627 Number of successful extensions: 586 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 556 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 586 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1613473434 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -