BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30291.Seq (698 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 29 2.2 At3g13670.1 68416.m01722 protein kinase family protein contains ... 27 9.0 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 29.5 bits (63), Expect = 2.2 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +3 Query: 321 DSLGVGSYG*TNTNSWKGNPSYVPXGSISLEGIVSEELN 437 D +G G+YG N +V +SLE IV E+LN Sbjct: 24 DEIGKGAYGRVYKGLDLENGDFVAIKQVSLENIVQEDLN 62 >At3g13670.1 68416.m01722 protein kinase family protein contains Pfam domains, PF00069: Protein kinase domain Length = 703 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 620 KPFSXXLGPRNXWRDGGSGKH 682 K F LG WR+GGSG+H Sbjct: 285 KLFLVDLGLATKWREGGSGQH 305 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,868,234 Number of Sequences: 28952 Number of extensions: 225638 Number of successful extensions: 503 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1496852856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -