BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30289.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1026 + 30214437-30214937 113 2e-25 02_05_0416 + 28791512-28792012 112 2e-25 06_01_0796 - 5932794-5934212,5934955-5935013,5936324-5936414 31 1.0 04_04_1574 - 34536744-34537136,34541247-34541405,34541497-345424... 29 4.2 04_04_1551 - 34348110-34348225,34348468-34348606,34348658-343488... 29 4.2 11_01_0669 - 5454116-5454153,5454569-5454770,5454865-5455029,545... 28 7.4 06_03_1069 - 27345207-27345488,27345746-27346078,27346252-273470... 28 7.4 09_06_0347 + 22445962-22446154,22446495-22446616,22446764-224468... 27 9.7 09_02_0192 - 5589395-5590021,5590120-5590560,5590781-5591242 27 9.7 >04_04_1026 + 30214437-30214937 Length = 166 Score = 113 bits (271), Expect = 2e-25 Identities = 58/101 (57%), Positives = 71/101 (70%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 KDWKGL++TV+LTVQNRQA+++VVPSAAAL+I+ALKEP RDRKK KNIKH+GNISL+DVI Sbjct: 52 KDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVI 111 Query: 432 GHCEDHEKQINGPVPFWLSKRDSWHRQSVGCTVEGRXAHDL 554 + K SVGCTV+G+ DL Sbjct: 112 EIARIMRNRSMAKEMAGTVKEILGTCVSVGCTVDGKDPKDL 152 Score = 95.5 bits (227), Expect = 3e-20 Identities = 61/139 (43%), Positives = 76/139 (54%), Gaps = 4/139 (2%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATRTG----RVS 270 MPPK DP ++ V +R GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T RV+ Sbjct: 1 MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT 60 Query: 271 RSLCS*QFKTDKXXXXXXXXXXXXXXXXXXXXXVTVKSRKISNTTATSPLKM*SGIAKIM 450 L + VK+ K S + + IA+IM Sbjct: 61 VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDV---IEIARIM 117 Query: 451 RNRSMARYLSGSVKEILGT 507 RNRSMA+ ++G+VKEILGT Sbjct: 118 RNRSMAKEMAGTVKEILGT 136 >02_05_0416 + 28791512-28792012 Length = 166 Score = 112 bits (270), Expect = 2e-25 Identities = 58/101 (57%), Positives = 71/101 (70%) Frame = +3 Query: 252 KDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQKNIKHNGNISLEDVI 431 KDWKGL++TV+LTVQNRQA+++VVPSAAAL+I+ALKEP RDRKK KNIKH+GNISL+DVI Sbjct: 52 KDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDVI 111 Query: 432 GHCEDHEKQINGPVPFWLSKRDSWHRQSVGCTVEGRXAHDL 554 + K SVGCTV+G+ DL Sbjct: 112 EIARVMRPRSMAKEMAGTVKEILGTCVSVGCTVDGKDPKDL 152 Score = 91.9 bits (218), Expect = 4e-19 Identities = 59/139 (42%), Positives = 75/139 (53%), Gaps = 4/139 (2%) Frame = +1 Query: 103 MPPKFDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATRTG----RVS 270 MPPK DP ++ V +R GGEVGA SSLAPKIGPLGLSPKK+G+DIAK T RV+ Sbjct: 1 MPPKLDPTQVVDVFVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVT 60 Query: 271 RSLCS*QFKTDKXXXXXXXXXXXXXXXXXXXXXVTVKSRKISNTTATSPLKM*SGIAKIM 450 L + VK+ K S + + IA++M Sbjct: 61 VKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKVKNIKHSGNISLDDV---IEIARVM 117 Query: 451 RNRSMARYLSGSVKEILGT 507 R RSMA+ ++G+VKEILGT Sbjct: 118 RPRSMAKEMAGTVKEILGT 136 >06_01_0796 - 5932794-5934212,5934955-5935013,5936324-5936414 Length = 522 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +3 Query: 240 CQGHKDWKGLKITVQLTVQNRQAQIAVVPSAAALIIRALKEPPRDRKKQ 386 C W + V V + + V+P+A A +IRA+ + P R++Q Sbjct: 27 CAAQGYWYSYLVDVDADVDDDMISLRVLPNARAALIRAVADAPGRREEQ 75 >04_04_1574 - 34536744-34537136,34541247-34541405,34541497-34542411, 34543642-34543731,34544324-34544390,34544483-34544676, 34544770-34545510,34545596-34545661,34545783-34545908, 34545978-34546073,34546153-34546521,34546602-34546724, 34546802-34546906,34547394-34547531,34547665-34547760, 34548018-34548275 Length = 1311 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -3 Query: 256 SLWPWQCHHPPF*ETDQEDRF*GPKMMWHRLPRRHIA 146 S+W C H P+ E D E R GP L R I+ Sbjct: 1181 SMWMLNCRHQPYREEDGELRIVGPPHQHAHLKRVRIS 1217 >04_04_1551 - 34348110-34348225,34348468-34348606,34348658-34348896, 34349042-34349140,34349207-34350188,34350737-34350832, 34350936-34351064,34351253-34351332,34351420-34351661, 34351743-34352692 Length = 1023 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/40 (42%), Positives = 23/40 (57%) Frame = +1 Query: 142 NLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKATRTG 261 N +C G E G S AP++ PLG+ PK G+ IA + G Sbjct: 736 NSKCAGAE-GINS--APRVTPLGIRPKG-GESIAPSLALG 771 >11_01_0669 - 5454116-5454153,5454569-5454770,5454865-5455029, 5455278-5456183 Length = 436 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +1 Query: 100 KMPPK-FDPNEIKIVNLRCVGGEVGATSSLAPKIGPLGLSPKKV 228 K+P + F N +KIV ++C G EV +G G+ +K+ Sbjct: 369 KIPEEPFVSNHLKIVEIKCKGKEVMWVCKFLKTLGTFGIPLEKI 412 >06_03_1069 - 27345207-27345488,27345746-27346078,27346252-27347041, 27347153-27347351,27347522-27347667,27347823-27348094, 27348161-27348262,27348351-27348470,27348576-27348729, 27348986-27349114,27349554-27349900 Length = 957 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = -1 Query: 120 VKLRGHFVDYLVQLYTIITLNPNGWVWIPQ 31 V LR H L L + +P W+WI Q Sbjct: 81 VSLRSHLASVLQSLSQVRPRSPASWIWISQ 110 >09_06_0347 + 22445962-22446154,22446495-22446616,22446764-22446885, 22447405-22447594,22447874-22448014,22448257-22448724, 22448842-22449609,22450185-22450373 Length = 730 Score = 27.5 bits (58), Expect = 9.7 Identities = 16/71 (22%), Positives = 29/71 (40%) Frame = -2 Query: 446 IFAMPDYIFKGDVAVVFDIFLLFTVTRRLLKGSDDKGCCRGNNSYLGLSVLNCQLHSDLE 267 ++ P+Y GD+ + D++ + RLL G G + + L L S Sbjct: 537 VYIDPEYAISGDLTPLSDVYSFGIILLRLLTGRSGFGLLKDVQRAVAKGCLQAILDSSAG 596 Query: 266 TLPVLVALAMS 234 P++ A +S Sbjct: 597 DWPLMHAEQLS 607 >09_02_0192 - 5589395-5590021,5590120-5590560,5590781-5591242 Length = 509 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 403 TATSPLKM*SGIAKIMRNRSMARYLSGSVKEIL 501 T TS M G++++MRN S+ + L ++E+L Sbjct: 308 TGTSASAMEWGMSELMRNPSVMKKLQAEIREVL 340 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,411,637 Number of Sequences: 37544 Number of extensions: 405054 Number of successful extensions: 1169 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1165 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -