BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= psV30283.Seq (776 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_18684| Best HMM Match : ATP-synt_F6 (HMM E-Value=1.5e-15) 44 2e-04 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 6e-04 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 40 0.003 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 39 0.005 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 38 0.007 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 38 0.009 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.012 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.016 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 36 0.028 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.028 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 36 0.028 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 36 0.028 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 36 0.028 SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 36 0.028 SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 36 0.028 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_16615| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.028 SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 36 0.028 SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.037 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 36 0.048 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 36 0.048 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 36 0.048 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 36 0.048 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 36 0.048 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 36 0.048 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 36 0.048 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 36 0.048 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 36 0.048 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 36 0.048 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 36 0.048 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 36 0.048 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 36 0.048 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 36 0.048 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 36 0.048 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 36 0.048 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 36 0.048 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.048 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 36 0.048 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 36 0.048 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 36 0.048 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 36 0.048 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 36 0.048 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 36 0.048 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 36 0.048 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 36 0.048 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 36 0.048 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 36 0.048 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 36 0.048 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 36 0.048 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 36 0.048 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 36 0.048 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 36 0.048 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 36 0.048 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 36 0.048 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 36 0.048 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 36 0.048 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 36 0.048 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 36 0.048 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 36 0.048 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 36 0.048 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 36 0.048 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 36 0.048 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 36 0.048 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 36 0.048 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 36 0.048 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 36 0.048 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 36 0.048 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 36 0.048 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 36 0.048 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 36 0.048 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.048 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/50 (50%), Positives = 28/50 (56%) Frame = +3 Query: 528 IRPXXSRITIHWXVVFTTSGLGKTXGYPXLIALQHIPXFGXLG*IXXKAR 677 +RP SRITIHW + GKT P LIALQHIP G I +AR Sbjct: 33 LRPVVSRITIHWTSFYNVV-TGKTLALPNLIALQHIP-LSPAGVIAEEAR 80 >SB_18684| Best HMM Match : ATP-synt_F6 (HMM E-Value=1.5e-15) Length = 175 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 7/58 (12%) Frame = -1 Query: 407 SKLVGLRAATTSMMVSRNL-------AAAQKATDPIQQLFLDKIREYKQKSAGGKVPD 255 S+L +T S+++ RN+ A K DPIQ+LF++K+ YKQKS GGK+ D Sbjct: 81 SRLAVASPSTCSIVLRRNIGTTYAAMAKMDKNADPIQRLFVEKLEAYKQKSKGGKLID 138 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.9 bits (94), Expect = 6e-04 Identities = 22/34 (64%), Positives = 23/34 (67%) Frame = +2 Query: 542 ESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 ESYY SL YNV TGK G+ LNRLAAH PF Sbjct: 2 ESYYNSLAV-VYNVVTGKTPGVTQLNRLAAHPPF 34 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 572 FYNVGTGKNLGLPXLNRLAAHSPF 643 FYNV TGKN G+ LNRLAAH PF Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 572 FYNVGTGKNLGLPXLNRLAAHSPF 643 FYNV TGKN G+ LNRLAAH PF Sbjct: 11 FYNVVTGKNTGVTQLNRLAAHPPF 34 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 41.1 bits (92), Expect = 0.001 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 572 FYNVGTGKNLGLPXLNRLAAHSPF 643 FYNV TGK LG+ LNRLAAH PF Sbjct: 9 FYNVVTGKTLGVTQLNRLAAHPPF 32 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/34 (58%), Positives = 21/34 (61%) Frame = +3 Query: 543 SRITIHWXVVFTTSGLGKTXGYPXLIALQHIPXF 644 SRITIHW + GKT P LIALQHIP F Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQHIPPF 34 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/35 (57%), Positives = 21/35 (60%) Frame = +3 Query: 534 PXXSRITIHWXVVFTTSGLGKTXGYPXLIALQHIP 638 P SRITIHW + GKT P LIALQHIP Sbjct: 77 PYMSRITIHWPSFYNVV-TGKTLALPNLIALQHIP 110 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 40.7 bits (91), Expect = 0.001 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = +2 Query: 572 FYNVGTGKNLGLPXLNRLAAHSPF 643 FYNV TGKN G+ LNRLAAH PF Sbjct: 11 FYNVVTGKNPGVTQLNRLAAHPPF 34 >SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL G+N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDGENTGVTQLNRLAAHPPF 55 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -1 Query: 644 KXGNVLQGD*XWVTXGFSQSRRCK 573 + G+VLQG WVT GFSQSRRCK Sbjct: 21 RKGDVLQGRLSWVTPGFSQSRRCK 44 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL G+N G+ LNRLAAH PF Sbjct: 684 NSPYSESYYNSLAVVLQR-RDGENTGVTQLNRLAAHPPF 721 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/24 (70%), Positives = 18/24 (75%) Frame = +2 Query: 572 FYNVGTGKNLGLPXLNRLAAHSPF 643 FYNV TGK L + LNRLAAH PF Sbjct: 11 FYNVVTGKTLSVTQLNRLAAHPPF 34 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = +3 Query: 543 SRITIHWXVVFTTSGLGKTXGYPXLIALQHIP 638 SRITIHW + GKT P LIALQHIP Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQHIP 32 >SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 38.7 bits (86), Expect = 0.005 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL G+N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDGENPGVTQLNRLAAHPPF 55 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = +3 Query: 543 SRITIHWXVVFTTSGLGKTXGYPXLIALQHIP 638 SRITIHW + GKT P LIALQHIP Sbjct: 2 SRITIHWPSFYNVV-TGKTLALPNLIALQHIP 32 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/45 (51%), Positives = 24/45 (53%) Frame = +3 Query: 510 GGARYPIRPXXSRITIHWXVVFTTSGLGKTXGYPXLIALQHIPXF 644 GGA PIRP SRITIHW F + GKT Y L L P F Sbjct: 36 GGA--PIRPIVSRITIHWP-AFYNAPTGKTLAYTQLNRLAAHPPF 77 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 637 GMCCKAIKXG*PXVFPSPDVVK 572 GMCCKAIK G VFPS DVVK Sbjct: 17 GMCCKAIKLGNASVFPSHDVVK 38 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -2 Query: 637 GMCCKAIKXG*PXVFPSPDVVK 572 GMCCKAIK G VFPS DVVK Sbjct: 31 GMCCKAIKLGNASVFPSHDVVK 52 >SB_7086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 37.5 bits (83), Expect = 0.012 Identities = 22/45 (48%), Positives = 24/45 (53%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPFWQXGVN 661 NSP ESYY SL +N G+ LNRLAAH PF G N Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPFASWGNN 61 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXWG 657 LQRRDWE P VTQ + + P A WG Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASWG 59 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +2 Query: 572 FYNVGTGKNLGLPXLNRLAAHSPF 643 FYNV TGK L LP L LAAH PF Sbjct: 11 FYNVVTGKTLALPNLIALAAHPPF 34 >SB_132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/39 (53%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL KN G+ LNRLAAH PF Sbjct: 28 NSPYSESYYNSLAVVLQR-RDWKNPGVTQLNRLAAHPPF 65 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 31 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 68 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPFWQXG 655 NSP ESYY SL +N G+ LNRLAAH PF G Sbjct: 56 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPFASWG 97 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXWG 657 LQRRDWE P VTQ + + P A WG Sbjct: 71 LQRRDWENPGVTQL-NRLAAHPPFASWG 97 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 43 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 80 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 40 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 77 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 41 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 78 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 46 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 83 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 35 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 72 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 84 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 121 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 26 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 63 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 24 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 61 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 504 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 541 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -1 Query: 611 WVTXGFSQSRRCK 573 WVT GFSQSRRCK Sbjct: 214 WVTPGFSQSRRCK 226 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 56 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 93 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 25 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 62 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 38 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 75 >SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 25 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 62 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 44 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 81 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 60 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 97 >SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 1354 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 1391 >SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 178 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 215 >SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 37 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 74 >SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 26 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 63 >SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) Length = 181 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 79 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 116 >SB_58017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 36 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 73 >SB_53901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_53039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_53031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_52947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_52078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 54 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 91 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 77 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 114 >SB_50042| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 42 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 79 >SB_50038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_48407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 86 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 123 >SB_48240| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 30 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 67 >SB_47429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_47410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_47128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 34 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 71 >SB_46311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 40 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 77 >SB_43898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 27 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 64 >SB_42650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 64 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 101 >SB_41637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_40439| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_37837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_36825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_36650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 45 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 82 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 644 KXGNVLQGD*XWVTXGFSQSRRCK 573 + G+VLQ WVT GFSQSRRCK Sbjct: 21 RKGDVLQRRLSWVTPGFSQSRRCK 44 >SB_35598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_35445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 250 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 149 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 186 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 39 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 76 >SB_33898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 107 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 144 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 94 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 131 >SB_29948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_29495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 59 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 96 >SB_27907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 24 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 61 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 46 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 83 >SB_26184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_25988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_25764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 33 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 70 >SB_24868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 29 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 66 >SB_21334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 32 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 69 >SB_20750| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_19713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 507 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 112 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 149 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 602 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 639 >SB_18964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 94 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 131 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 74 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 111 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 127 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 164 >SB_16615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVSQLNRLAAHPPF 55 >SB_16561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_15671| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 139 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 37 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 74 >SB_14548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_14300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 222 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/43 (48%), Positives = 23/43 (53%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPFWQXG 655 NSP ESYY SL +N G+ LNRLAAH PF G Sbjct: 120 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPFASWG 161 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXWG 657 LQRRDWE P VTQ + + P A WG Sbjct: 135 LQRRDWENPGVTQL-NRLAAHPPFASWG 161 >SB_14046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_13143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) Length = 283 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 181 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 218 >SB_10857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_10647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 30 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 67 >SB_10117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_10054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 35 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 72 >SB_9213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 43 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 80 >SB_9035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 58 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 95 >SB_8834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 36 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 73 >SB_7369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_5748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_4857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 27 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 64 >SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 24 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 61 >SB_4254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_3679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 27 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 64 >SB_1518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 55 >SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 42 NSPYSESYYNSLAVVLQR-RDWENTGVTQLNRLAAHPPF 79 >SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLRR-RDWENTGVTPLNRLAAHPPF 55 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 33 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 70 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 48 LQRRDWENPGVTQL-NRLAAHPPFASW 73 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 56 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 93 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 71 LQRRDWENPGVTQL-NRLAAHPPFASW 96 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 47 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 84 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 62 LQRRDWENPGVTQL-NRLAAHPPFASW 87 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 24 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 61 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 39 LQRRDWENPGVTQL-NRLAAHPPFASW 64 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 39 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 76 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 54 LQRRDWENPGVTQL-NRLAAHPPFASW 79 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 48 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 85 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 63 LQRRDWENPGVTQL-NRLAAHPPFASW 88 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 29 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 66 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 44 LQRRDWENPGVTQL-NRLAAHPPFASW 69 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 205 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 242 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 220 LQRRDWENPGVTQL-NRLAAHPPFASW 245 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 100 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 137 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 115 LQRRDWENPGVTQL-NRLAAHPPFASW 140 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 36 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 73 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 51 LQRRDWENPGVTQL-NRLAAHPPFASW 76 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 370 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 407 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 385 LQRRDWENPGVTQL-NRLAAHPPFASW 410 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 28 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 65 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 43 LQRRDWENPGVTQL-NRLAAHPPFASW 68 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 27 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 64 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 42 LQRRDWENPGVTQL-NRLAAHPPFASW 67 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 34 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 71 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 49 LQRRDWENPGVTQL-NRLAAHPPFASW 74 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 329 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 366 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 344 LQRRDWENPGVTQL-NRLAAHPPFASW 369 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 69 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 106 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 84 LQRRDWENPGVTQL-NRLAAHPPFASW 109 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 39 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 76 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 54 LQRRDWENPGVTQL-NRLAAHPPFASW 79 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 48 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 85 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 63 LQRRDWENPGVTQL-NRLAAHPPFASW 88 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 32 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 69 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 47 LQRRDWENPGVTQL-NRLAAHPPFASW 72 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 123 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 160 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 138 LQRRDWENPGVTQL-NRLAAHPPFASW 163 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 52 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 89 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 67 LQRRDWENPGVTQL-NRLAAHPPFASW 92 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 28 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 65 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 43 LQRRDWENPGVTQL-NRLAAHPPFASW 68 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 245 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 282 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 260 LQRRDWENPGVTQL-NRLAAHPPFASW 285 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 25 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 62 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 40 LQRRDWENPGVTQL-NRLAAHPPFASW 65 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 103 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 140 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 118 LQRRDWENPGVTQL-NRLAAHPPFASW 143 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 23 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 60 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 38 LQRRDWENPGVTQL-NRLAAHPPFASW 63 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 385 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 422 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 400 LQRRDWENPGVTQL-NRLAAHPPFASW 425 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 108 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 145 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 123 LQRRDWENPGVTQL-NRLAAHPPFASW 148 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 403 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 440 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 418 LQRRDWENPGVTQL-NRLAAHPPFASW 443 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 45 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 82 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 60 LQRRDWENPGVTQL-NRLAAHPPFASW 85 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 35 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 72 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 50 LQRRDWENPGVTQL-NRLAAHPPFASW 75 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 52 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 89 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 67 LQRRDWENPGVTQL-NRLAAHPPFASW 92 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 174 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 211 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 189 LQRRDWENPGVTQL-NRLAAHPPFASW 214 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 23 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 60 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 38 LQRRDWENPGVTQL-NRLAAHPPFASW 63 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 29 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 66 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 44 LQRRDWENPGVTQL-NRLAAHPPFASW 69 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 43 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 80 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 58 LQRRDWENPGVTQL-NRLAAHPPFASW 83 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 40 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 77 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 55 LQRRDWENPGVTQL-NRLAAHPPFASW 80 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 24 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 61 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 39 LQRRDWENPGVTQL-NRLAAHPPFASW 64 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 38 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 75 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 53 LQRRDWENPGVTQL-NRLAAHPPFASW 78 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 28 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 65 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 43 LQRRDWENPGVTQL-NRLAAHPPFASW 68 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 73 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 110 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 88 LQRRDWENPGVTQL-NRLAAHPPFASW 113 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 329 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 366 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 344 LQRRDWENPGVTQL-NRLAAHPPFASW 369 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 75 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 112 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 90 LQRRDWENPGVTQL-NRLAAHPPFASW 115 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 25 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 62 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 40 LQRRDWENPGVTQL-NRLAAHPPFASW 65 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 283 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 320 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 298 LQRRDWENPGVTQL-NRLAAHPPFASW 323 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 46 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 83 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 61 LQRRDWENPGVTQL-NRLAAHPPFASW 86 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 400 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 437 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 415 LQRRDWENPGVTQL-NRLAAHPPFASW 440 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 40 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 77 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 55 LQRRDWENPGVTQL-NRLAAHPPFASW 80 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 32 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 69 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 47 LQRRDWENPGVTQL-NRLAAHPPFASW 72 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 82 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 119 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 97 LQRRDWENPGVTQL-NRLAAHPPFASW 122 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 200 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 237 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 215 LQRRDWENPGVTQL-NRLAAHPPFASW 240 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 32 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 69 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 47 LQRRDWENPGVTQL-NRLAAHPPFASW 72 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 32 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 69 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 47 LQRRDWENPGVTQL-NRLAAHPPFASW 72 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 34 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 71 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 49 LQRRDWENPGVTQL-NRLAAHPPFASW 74 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 24 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 61 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 39 LQRRDWENPGVTQL-NRLAAHPPFASW 64 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 184 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 221 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 199 LQRRDWENPGVTQL-NRLAAHPPFASW 224 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 42 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 79 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 57 LQRRDWENPGVTQL-NRLAAHPPFASW 82 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 75 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 112 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 90 LQRRDWENPGVTQL-NRLAAHPPFASW 115 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 38 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 75 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 53 LQRRDWENPGVTQL-NRLAAHPPFASW 78 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 176 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 213 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 191 LQRRDWENPGVTQL-NRLAAHPPFASW 216 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 56 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 93 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 71 LQRRDWENPGVTQL-NRLAAHPPFASW 96 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 39 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 76 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 54 LQRRDWENPGVTQL-NRLAAHPPFASW 79 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 65 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 102 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 80 LQRRDWENPGVTQL-NRLAAHPPFASW 105 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 85 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 122 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 100 LQRRDWENPGVTQL-NRLAAHPPFASW 125 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 29 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 66 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 44 LQRRDWENPGVTQL-NRLAAHPPFASW 69 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 38 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 75 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 53 LQRRDWENPGVTQL-NRLAAHPPFASW 78 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 652 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 689 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 667 LQRRDWENPGVTQL-NRLAAHPPFASW 692 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 37 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 74 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 52 LQRRDWENPGVTQL-NRLAAHPPFASW 77 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 26 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 63 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 41 LQRRDWENPGVTQL-NRLAAHPPFASW 66 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 25 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 62 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 40 LQRRDWENPGVTQL-NRLAAHPPFASW 65 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 32 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 69 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 47 LQRRDWENPGVTQL-NRLAAHPPFASW 72 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 69 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 106 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 84 LQRRDWENPGVTQL-NRLAAHPPFASW 109 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 19 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 56 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 34 LQRRDWENPGVTQL-NRLAAHPPFASW 59 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 34 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 71 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 49 LQRRDWENPGVTQL-NRLAAHPPFASW 74 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 64 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 101 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 79 LQRRDWENPGVTQL-NRLAAHPPFASW 104 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 35.5 bits (78), Expect = 0.048 Identities = 20/39 (51%), Positives = 22/39 (56%) Frame = +2 Query: 527 NSPXXESYYXSLGRRFYNVGTGKNLGLPXLNRLAAHSPF 643 NSP ESYY SL +N G+ LNRLAAH PF Sbjct: 18 NSPYSESYYNSLAVVLQR-RDWENPGVTQLNRLAAHPPF 55 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = +1 Query: 574 LQRRDWEKPXVTQX*SPCSTFPXLAXW 654 LQRRDWE P VTQ + + P A W Sbjct: 33 LQRRDWENPGVTQL-NRLAAHPPFASW 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,863,170 Number of Sequences: 59808 Number of extensions: 356209 Number of successful extensions: 7290 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3279 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4739 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2119930593 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -